BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0604 (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 26 0.24 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 6.8 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 6.8 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 9.0 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 26.2 bits (55), Expect = 0.24 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 151 HTLVGHEDWVRGLDVLEVDNDTIIV 225 H LVG E +G+ +E+++DT+ V Sbjct: 132 HNLVGREGCKKGVCTMEINSDTMCV 156 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = -1 Query: 428 RTIKTIRMPLYPIDPGFMTGKHCLKFHRPKIVICMEHFFLNLNQ 297 ++ K + P + P + LK PK+ +CM++ +N +Q Sbjct: 580 KSAKPMLKPWQRVLPDGVFVAFLLKHIVPKLQLCMQNLVINPHQ 623 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 6.8 Identities = 12/54 (22%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +2 Query: 23 LYILVYVSPFTRKYYHAQINRYYFVHWMTTKYIY--SLVRTITERILWLDTKTG 178 ++IL + + YH +I +YY + + +Y S + I ++ +TG Sbjct: 308 VFILWIILVPEEQVYHLEIEKYYNILYFCRIMVYLNSAINPILYNLMSSKFRTG 361 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -3 Query: 177 PVFVSNQSMRSVIVLTNEYM 118 PVF+ S ++V + N+Y+ Sbjct: 16 PVFIGKGSKKTVFDIPNDYL 35 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 324 HAYDNLWSVKLEAVLAGHEAWVYGVQWHPYSFD 422 +++DN S ++ L E Y W+ SFD Sbjct: 205 YSFDNQCSGTIDWALPKQEDCFYQEGWNGQSFD 237 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,362 Number of Sequences: 336 Number of extensions: 3704 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -