BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0604 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11879| Best HMM Match : WD40 (HMM E-Value=5.8e-21) 34 0.12 SB_42943| Best HMM Match : WD40 (HMM E-Value=0) 32 0.48 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 32 0.48 SB_32324| Best HMM Match : WD40 (HMM E-Value=6.4e-21) 32 0.48 SB_3045| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_29408| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.51 SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 30 1.9 SB_16656| Best HMM Match : Methyltransf_3 (HMM E-Value=1.2e-19) 30 1.9 SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_48619| Best HMM Match : DUF1572 (HMM E-Value=0.33) 29 3.4 SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_47014| Best HMM Match : rve (HMM E-Value=6.8e-21) 28 7.7 SB_32323| Best HMM Match : WD40 (HMM E-Value=0) 28 7.7 SB_18201| Best HMM Match : rve (HMM E-Value=3.6e-21) 28 7.7 SB_144| Best HMM Match : rve (HMM E-Value=3.6e-21) 28 7.7 >SB_11879| Best HMM Match : WD40 (HMM E-Value=5.8e-21) Length = 447 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = +3 Query: 420 DGPTKKPVYRLLSSSLDKTLIIWEPD 497 DG +P+ LLS+SLDK+L+IW+PD Sbjct: 14 DGTFTQPMC-LLSASLDKSLVIWQPD 38 >SB_42943| Best HMM Match : WD40 (HMM E-Value=0) Length = 273 Score = 31.9 bits (69), Expect = 0.48 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +3 Query: 348 VKLEAVLAGHEAWVYGVQWHPYSFDGPTKKPVYRLLSSSLDKTLIIWE 491 + L L GH WV + +P + D +LSSS DK LI+WE Sbjct: 42 LSLRGTLKGHNGWVTQIATNPSNPD--------TILSSSRDKKLIVWE 81 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 31.9 bits (69), Expect = 0.48 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +1 Query: 103 DDHKIHIFVGEDYH--RAHTLVGHEDWVRGLDVLEVDNDTIIVASASQDTYIR-CGRYKR 273 D K H F+ D+ + LVG E+ VRGLD E+D+ ++ + + Y+ CGR R Sbjct: 463 DPTKYHKFL-RDFRTGQIQLLVGTEETVRGLDFKELDHVYLMEVPKNVEEYLHLCGRVGR 521 >SB_32324| Best HMM Match : WD40 (HMM E-Value=6.4e-21) Length = 123 Score = 31.9 bits (69), Expect = 0.48 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +3 Query: 348 VKLEAVLAGHEAWVYGVQWHPYSFDGPTKKPVYRLLSSSLDKTLIIWE 491 + L L GH WV + +P + D +LSSS DK LI+WE Sbjct: 5 LSLRGTLKGHNGWVTQIATNPSNPD--------TILSSSRDKKLIVWE 44 >SB_3045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 213 HNYRSVGFSRYIHSLWKIQKVKAQPESKLIKVEEKVFHAYDNLWSVKLEAVLAGH 377 H+ R + S+YI+++W+ + S+ + + HAY +V + AV H Sbjct: 291 HSIRGMKRSQYIYAVWRGHSTRGMIRSQYTRYDTVTVHAYTRYDTVTIHAVWHDH 345 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = +3 Query: 246 IHSLWKIQKVKAQPESKLIKVEEKVFHAYDNLWSVKLEAVLAGHEA 383 +H++W + S+ + + HAY +VK+ AV H A Sbjct: 190 VHAVWYGHSTRGMARSQYTRYDTVTVHAYTRYDTVKVHAVWHDHSA 235 >SB_29408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +3 Query: 216 NYRSVGFSRYIHSLWKIQKVKAQPESKLIKVEEKVFHAYDNLWSVKLEAVLAGHEAW 386 N R + S+YIH++W + S+ I Y +V + AV GH + Sbjct: 15 NTRGMVRSQYIHAVWHDHSTRGMIRSQYIHAVWYGHSTYTRYGTVTVHAVWHGHSTY 71 Score = 27.5 bits (58), Expect(2) = 0.51 Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +3 Query: 237 SRYIHSLWKIQKVKAQPESKLIKVEEKVFHAYDNLWSVKLEAVLAGHEAWV-YG 395 S+YIH++W + S+ I Y +V + AV GH + YG Sbjct: 152 SQYIHAVWHGHSTRGMARSQYIHAVWYGHSTYTRCGTVTVHAVWYGHSTYTRYG 205 Score = 23.0 bits (47), Expect(2) = 0.51 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 213 HNYRSVGFSRYIHSLW 260 H+ R + S+YIH++W Sbjct: 115 HSTRGMARSQYIHAVW 130 >SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 31.5 bits (68), Expect = 0.63 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = +3 Query: 333 DNLWSVKLEAVLAGHEAWVYGVQWHPYSFDGPTKKPVYRLLSSSLDKTLIIWEPDSSST 509 DNL + + +L GH VY + W P DG +LLS S+D + IIW+ T Sbjct: 165 DNLETWTVSKMLRGHIEDVYDLAWSP---DGT------QLLSGSVDNSAIIWDAIKGKT 214 >SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1649 Score = 31.1 bits (67), Expect = 0.83 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 106 DHKIHIFVGEDYHRAHTLVGHEDWVRGLDVLEVDNDTIIVAS 231 DH + I+ + HTL GH++WV G+ ++ D+ II +S Sbjct: 769 DHTVKIWDMDTLSLVHTLKGHKNWVSGV-LVTPDSKRIISSS 809 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +3 Query: 345 SVKLEAVLAGHEAWVYGVQWHPYSFDGPTKKPVYRLLSSSLDKTLIIWEPDS 500 ++ L L GH+ WV GV P S R++SSS DKT+ IW+ ++ Sbjct: 779 TLSLVHTLKGHKNWVSGVLVTPDS---------KRIISSSYDKTVKIWDVET 821 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -2 Query: 211 RYQLPTRQVP*PSLRVQPEYALCDSPHQRI---YVFCGHPVHKVIAVY 77 RY +PT + P P R P Y P++++ Y HP +V A Y Sbjct: 646 RYPIPTNRYPLPKNRYPPPYKQVPPPYKQVPHPYKQVPHPYKQVPAPY 693 >SB_16656| Best HMM Match : Methyltransf_3 (HMM E-Value=1.2e-19) Length = 613 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Frame = +3 Query: 324 HAYDNLWSVKLE---AVLAGHEAWVYGVQWHPY-SF--DGPTKKPVYRLLSSSLDKTLII 485 HAY + WS E +L GH A G+ + Y SF D TK+ +YR+L+ L + Sbjct: 175 HAYGHTWSPGYELPAGMLHGH-AVATGMGFGAYLSFCNDWITKQELYRILNLLSGLELSL 233 Query: 486 WEPDSSSTTKV 518 W P K+ Sbjct: 234 WHPVMCDNMKI 244 >SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/56 (33%), Positives = 23/56 (41%) Frame = +3 Query: 384 WVYGVQWHPYSFDGPTKKPVYRLLSSSLDKTLIIWEPDSSSTTKVSG*RRSGWAKW 551 W+ G W Y D PT RLL S L + I+ P S T + R G W Sbjct: 219 WITGYNWS-YVLDAPTADAKCRLLYSVLQNAVDIYFPAKSIKTSLGS--RVGSKAW 271 >SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +2 Query: 17 VYLYILVYVSPFTRKYYHAQINRYYFVHWMTTKYIYSLV 133 +Y+YI +Y+ +T Y + Y + + T Y Y+ V Sbjct: 17 IYIYIYIYIYIYTYTYTYTYTYTYTYTYTYTYTYTYTYV 55 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 17 VYLYILVYVSPFTRKYYHAQINRYYFVHWMTTKYIYSLV 133 +Y+YI +Y +T Y + Y + + T Y+Y V Sbjct: 21 IYIYIYIYTYTYTYTYTYTYTYTYTYTYTYTYTYVYVYV 59 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 17 VYLYILVYVSPFTRKYYHAQINRYYFVHWMTTKYIYSLV 133 +Y+YI +Y+ +T Y + Y + + T Y Y V Sbjct: 19 IYIYIYIYIYTYTYTYTYTYTYTYTYTYTYTYTYTYVYV 57 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +2 Query: 17 VYLYILVYVSPFTRKYYHAQINRYYFVHWMTTKYIYSLVRTIT 145 +Y+YI +Y+ + Y + Y + + T Y Y+ T T Sbjct: 11 IYIYIYIYIYIYIYIYIYTYTYTYTYTYTYTYTYTYTYTYTYT 53 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 17 VYLYILVYVSPFTRKYYHAQINRYYFVHWMTTKYIYSLV 133 +Y+YI Y +T Y + Y + + T Y+Y V Sbjct: 23 IYIYIYTYTYTYTYTYTYTYTYTYTYTYTYTYVYVYVYV 61 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/56 (23%), Positives = 26/56 (46%) Frame = +2 Query: 23 LYILVYVSPFTRKYYHAQINRYYFVHWMTTKYIYSLVRTITERILWLDTKTGLGDL 190 LY+L + + +A I+ +F+HW +++L +R L + KT + Sbjct: 980 LYLLAALFDHEAMFCYAGISARFFLHWFAAVSVFTLAVISVDRFLAVRLKTAYSSI 1035 >SB_48619| Best HMM Match : DUF1572 (HMM E-Value=0.33) Length = 478 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/66 (25%), Positives = 31/66 (46%) Frame = -2 Query: 631 RAIVTMSQEGHTFWSKTAPVETQASASHFAHPDLLYPDTFVVLLESGSQIIRVLSSDDDR 452 R+++T+ E TF++ T P+ A H ++ D F + S +++ + S D R Sbjct: 402 RSVLTLKFELRTFYNSTPPLGIDIPAKHTPEQKTVW-DRFRKRIGSELPVVQCIQSFDKR 460 Query: 451 RRYTGF 434 T F Sbjct: 461 LSSTAF 466 >SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 28.7 bits (61), Expect = 4.4 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +3 Query: 339 LWSVKLE---AVLAGHEAWVYGVQWHPYSFDGPTKKPVYRLLSSSLDKTLIIWEPDSSST 509 +W VK E AVL GH V V W+P P+ + S+S D T+ IW P + T Sbjct: 231 IWHVKNERPIAVLCGHTRTVNCVTWNPLV---PS-----MMASASDDGTVRIWGPSTEET 282 Query: 510 T 512 + Sbjct: 283 S 283 >SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +3 Query: 366 LAGHEAWVYGVQWHPYSFDGPTKKPVYRLLSSSLDKTLIIWEPDSSSTTKVS 521 L GH YG+ W+P + +G LLS+S D T+ +W+ S + VS Sbjct: 239 LKGHTKEGYGLSWNP-NVNG-------NLLSASDDHTICLWDISSGISKDVS 282 >SB_47014| Best HMM Match : rve (HMM E-Value=6.8e-21) Length = 752 Score = 27.9 bits (59), Expect = 7.7 Identities = 20/80 (25%), Positives = 33/80 (41%) Frame = +3 Query: 219 YRSVGFSRYIHSLWKIQKVKAQPESKLIKVEEKVFHAYDNLWSVKLEAVLAGHEAWVYGV 398 Y S F + + W+I V P K KV A + + + ++A G + W + Sbjct: 639 YSSQEFREFTKA-WEIYHVTVSPHHH--KSNGKVESAVNIMKRIIIKAKKDGSDLWKSLL 695 Query: 399 QWHPYSFDGPTKKPVYRLLS 458 +W G + P RL+S Sbjct: 696 EWRNSPTPGTSSSPAQRLMS 715 >SB_32323| Best HMM Match : WD40 (HMM E-Value=0) Length = 611 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 79 KPLLLCALDDHKIHIFVGEDYHRAHTLVGHEDWVR 183 +PL + DD+KI ++ + TL+GH D++R Sbjct: 63 QPLFVSGGDDYKIKVWNYKQKRCLFTLLGHLDYIR 97 >SB_18201| Best HMM Match : rve (HMM E-Value=3.6e-21) Length = 322 Score = 27.9 bits (59), Expect = 7.7 Identities = 20/80 (25%), Positives = 33/80 (41%) Frame = +3 Query: 219 YRSVGFSRYIHSLWKIQKVKAQPESKLIKVEEKVFHAYDNLWSVKLEAVLAGHEAWVYGV 398 Y S F + + W+I V P K KV A + + + ++A G + W + Sbjct: 152 YSSQEFREFTKA-WEIYHVTVSPHHH--KSNGKVESAVNIMKRIIIKAKKDGSDLWKSLL 208 Query: 399 QWHPYSFDGPTKKPVYRLLS 458 +W G + P RL+S Sbjct: 209 EWRNSPTPGTSSSPAQRLMS 228 >SB_144| Best HMM Match : rve (HMM E-Value=3.6e-21) Length = 887 Score = 27.9 bits (59), Expect = 7.7 Identities = 20/80 (25%), Positives = 33/80 (41%) Frame = +3 Query: 219 YRSVGFSRYIHSLWKIQKVKAQPESKLIKVEEKVFHAYDNLWSVKLEAVLAGHEAWVYGV 398 Y S F + + W+I V P K KV A + + + ++A G + W + Sbjct: 717 YSSQEFREFTKA-WEIYHVTVSPHHH--KSNGKVESAVNIMKRIIIKAKKDGSDLWKSLL 773 Query: 399 QWHPYSFDGPTKKPVYRLLS 458 +W G + P RL+S Sbjct: 774 EWRNSPTPGTSSSPAQRLMS 793 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,871,806 Number of Sequences: 59808 Number of extensions: 467700 Number of successful extensions: 1470 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1452 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -