BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0597 (857 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 29 6.4 SB_36894| Best HMM Match : PXA (HMM E-Value=2.5e-13) 28 8.5 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 28.7 bits (61), Expect = 6.4 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = -3 Query: 738 KNLTRVRFWPEALMLCTTLI*HASAILQIAACLNVFKGSISGSKELL 598 K+ T + W E+LM CT+L Q+ LN GSI+ SK +L Sbjct: 1584 KDKTVLERWEESLMACTSL-------SQVFVHLNTLDGSIAWSKSVL 1623 >SB_36894| Best HMM Match : PXA (HMM E-Value=2.5e-13) Length = 1252 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -3 Query: 204 IDRPYVVLWYPFTGFLQKLLCRTAKALHVTKFAGF*KSISIGSH 73 I+R +VV W+ G + + T KAL + G+ ++ + +H Sbjct: 308 INRDFVVSWFRDVGEGEGFVGETRKALEILSLEGYKRACDVDAH 351 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,908,004 Number of Sequences: 59808 Number of extensions: 504371 Number of successful extensions: 1056 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1056 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -