BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0596 (938 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37950.1 68417.m05365 expressed protein 28 7.8 At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related simil... 28 7.8 >At4g37950.1 68417.m05365 expressed protein Length = 678 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +2 Query: 380 TMLQRWTS--YEGNEKRGNYKDRERWKRV 460 T L +TS Y G + NYK +E WK+V Sbjct: 297 TTLSMFTSVHYAGKDMNTNYKSKEPWKKV 325 >At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related similar to U2 small nuclear ribonucleoprotein auxiliary factor 35 kD subunit related protein 1 (sp|Q15695) Length = 757 Score = 28.3 bits (60), Expect = 7.8 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +1 Query: 220 MDGSDREQREREFVRSTAGSR---LEHRPAAHQNSNDSLGGWEDGEFEPIEENADE 378 M+ +++ E E R R LE + ND G EDGE+E IEE E Sbjct: 104 MEIKRKKEEEEEAKREEEERRWKDLEELRKLEASGNDECGEDEDGEYEYIEEGPPE 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,394,441 Number of Sequences: 28952 Number of extensions: 230030 Number of successful extensions: 550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2246578488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -