BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0592 (743 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 25 0.75 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 25 0.75 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 5.3 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 9.2 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 9.2 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.75 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 128 FSRQLRHDLRSIN*KEESSCFISNSTSNEC 39 F R +R DL S +EE SC I N C Sbjct: 134 FKRTVRKDL-SYACREEKSCIIDKRQRNRC 162 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.75 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 128 FSRQLRHDLRSIN*KEESSCFISNSTSNEC 39 F R +R DL S +EE SC I N C Sbjct: 134 FKRTVRKDL-SYACREEKSCIIDKRQRNRC 162 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 92 N*KEESSCFISNSTSNEC 39 N E ++C ISNS +N C Sbjct: 165 NSPENNTCSISNSYTNGC 182 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 682 RNADGDDXVIAYRKVIHGDSQRIEN 608 RN+ D + IHGDS++I++ Sbjct: 240 RNSTKDTLNSVVQGAIHGDSRQIQS 264 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 9.2 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 37 KHSLLVLLLMKQELSSF*LMDRRSCLSWRENRSQTSV 147 KHS +V +LM ++ +S L+ C + +NR ++ Sbjct: 115 KHSNIVKVLMIEQGASLSLITMELCGTTLQNRLDEAI 151 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,903 Number of Sequences: 438 Number of extensions: 3731 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -