BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0591 (768 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 55 2e-06 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 37 0.63 UniRef50_Q8D5M0 Cluster: Diadenosine tetraphosphate hydrolase; n... 33 7.8 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 54.8 bits (126), Expect = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 671 ELTAHLVLNGYWSPIDIYNVNAPTTLRYKF 582 ELTAHLVL+GYWSP +Y+VNAP T RYKF Sbjct: 162 ELTAHLVLSGYWSPRHLYDVNAPPTSRYKF 191 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 36.7 bits (81), Expect = 0.63 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +2 Query: 512 AGWWYLPVRTRKRSYH 559 A WWYLP RT KRSYH Sbjct: 569 AEWWYLPARTHKRSYH 584 >UniRef50_Q8D5M0 Cluster: Diadenosine tetraphosphate hydrolase; n=2; Vibrio vulnificus|Rep: Diadenosine tetraphosphate hydrolase - Vibrio vulnificus Length = 157 Score = 33.1 bits (72), Expect = 7.8 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +3 Query: 87 YAHFHSKPRVRQRSVFCYKKLYTRFLN*FTKLSLA*YLKNRSFVHQTWR 233 + H H PR + SV Y +L TRF+N + ++ LK VHQ W+ Sbjct: 101 HVHLHLIPRKKGDSVHFYWRLLTRFINPLSPMNTLARLKR---VHQKWQ 146 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 748,019,912 Number of Sequences: 1657284 Number of extensions: 14289515 Number of successful extensions: 26503 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26503 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 64204279620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -