BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0591 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 3.1 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 7.2 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 7.2 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 7.2 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 7.2 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +1 Query: 37 DQKENSAKYVRNLLRFDTPISIPNHALDSDQYFATKNFTHV 159 DQ +S Y+ + F + ++IP+ +D DQ + ++ T V Sbjct: 372 DQDYSSQNYL-TVHSFPSTLNIPSVKIDEDQKCSIESITSV 411 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -2 Query: 755 MINKWIYLNHNFERYYKR 702 +I+KW YL+++F+ +R Sbjct: 38 VIHKWKYLDYDFDNDERR 55 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +2 Query: 23 GECDQTKKRIVQNTYVTF*DLIRPFPFQTTR 115 G C + ++R+V++ + + LIRP T + Sbjct: 21 GLCSEDEERLVRDLFRGYNKLIRPVQNMTEK 51 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 NLLGNITVINILRTYIGIM 398 N+L +I + +LRT G+M Sbjct: 265 NILSHINTVYVLRTKKGVM 283 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 342 NLLGNITVINILRTYIGIM 398 N+L +I + +LRT G+M Sbjct: 265 NILSHINTVYVLRTKKGVM 283 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,464 Number of Sequences: 438 Number of extensions: 4710 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -