BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0584 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 3.0 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 4.0 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 5.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.2 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -1 Query: 685 WTLLFIGDVKYLSDKSFSNPDSKSSLQALAKFPFKSQPI 569 +T + +KY +D + PD + L L K P K + I Sbjct: 249 FTRVVTDTIKYRNDNNIVRPDFINMLMELQKNPQKLENI 287 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 346 HSGIMALKQNITEGYNQPFLPNHG 275 HS I L N+ GY+ P+ G Sbjct: 3 HSNISELLDNLLRGYDNSVRPDFG 26 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 601 LAKFPFKSQPIYPILLDCRNLLMKCMDQNLTYHLYGYL 488 L FP Q IL C+ + ++ ++ + L+GYL Sbjct: 166 LRNFPMDRQSCPLILGSCKCIYVQSINLCMAGRLFGYL 203 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 418 ISPQLIASFAILSTISFPLIPQWLGIHTND 507 +SP L A+ +++ +IP GI+T D Sbjct: 1103 MSPPLSAANGVITGYKVIVIPSGGGIYTKD 1132 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 515 SYISFVWIPSHCGIKGNEIVDRIANEAINC 426 SY+S ++ S+ GIK E ++ + + C Sbjct: 281 SYVSIIYEESNYGIKAFEELEELLGKRNIC 310 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,175 Number of Sequences: 438 Number of extensions: 4061 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -