BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0581 (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 25 0.67 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.6 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 25.0 bits (52), Expect = 0.67 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 324 KPSAIFKISNLKKLHELTNENKFMGTFGQQQICHNAQIGISIEPEANVQ 470 KP F LH +T+ NKF+ + ++ +++++ I N++ Sbjct: 87 KPDTYFYNGKHSYLHTITSPNKFVRLYQDGRVLYSSRLTIKAGCPMNLE 135 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 193 INHVAVFLTGAVPLPPGTAAMSTGAGLTQPHLLT 294 ++H+ V A P PP ++ STG+ + + +L T Sbjct: 341 MHHLHVAKQMASPEPPKSSESSTGSSIPKLNLST 374 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,490 Number of Sequences: 438 Number of extensions: 4019 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -