BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0581 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24820.1 68415.m02969 Rieske [2Fe-2S] domain-containing prote... 29 3.8 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 28 5.0 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 28 5.0 At5g63470.1 68418.m07968 CCAAT-box binding transcription factor ... 28 6.6 At2g21810.1 68415.m02592 CHP-rich zinc finger protein, putative 27 8.8 >At2g24820.1 68415.m02969 Rieske [2Fe-2S] domain-containing protein similar to Rieske iron-sulfur protein Tic55 from Pisum sativum [gi:2764524]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 539 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/66 (28%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +3 Query: 204 SSISDRSCTST--TWNSSNVYWSWPDPAAPPNWQLLGHISNIKPSAIFKISNLKKL---H 368 + I +C T +S V W W PPN + L N F IS +L H Sbjct: 171 AKIPKAACVKTYEVKDSQGVVWVWMSTKTPPNPEKLPWFENFARPGFFDISTTHELPYDH 230 Query: 369 ELTNEN 386 + EN Sbjct: 231 SILLEN 236 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 299 LPVRRCGWVRPAPVDIAAVP 240 L +RRC +VRP PV A+P Sbjct: 164 LNIRRCKYVRPTPVQRHAIP 183 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 299 LPVRRCGWVRPAPVDIAAVP 240 L +RRC +VRP PV A+P Sbjct: 164 LNIRRCKYVRPTPVQRHAIP 183 >At5g63470.1 68418.m07968 CCAAT-box binding transcription factor Hap5a, putative Length = 250 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 214 LTGAVPLPP-GTAAMSTGAGLTQPHLL 291 +T +P PP G+A++ TG G T HLL Sbjct: 24 VTTVIPPPPSGSASIVTGGGATYHHLL 50 >At2g21810.1 68415.m02592 CHP-rich zinc finger protein, putative Length = 128 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 493 SKKQTICDICSENVRKLSQFCSI 561 S+++ CDIC EN+ + FC I Sbjct: 68 SQEKMKCDICRENIYDFNLFCRI 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,458,760 Number of Sequences: 28952 Number of extensions: 293350 Number of successful extensions: 891 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -