BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0580 (538 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizo... 26 3.1 SPBC4B4.07c |usp102|mud1|U1 snRNP-associated protein Usp102|Schi... 26 3.1 >SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 26.2 bits (55), Expect = 3.1 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 5/45 (11%) Frame = -1 Query: 514 TFRRELLPKRNHLYP-----KLAKTKHYVPFPLLFVEAINDLTKK 395 TF R+LLP+ NH P +L + K+ LF + I++L KK Sbjct: 212 TFARDLLPETNHYSPSHAFIRLLEKKN--KLSTLFTQNIDNLEKK 254 >SPBC4B4.07c |usp102|mud1|U1 snRNP-associated protein Usp102|Schizosaccharomyces pombe|chr 2|||Manual Length = 249 Score = 26.2 bits (55), Expect = 3.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 538 IQPRIQDLTFRRELLPKRNHLYPKLAKTKHYVPFP 434 I+ R +D RRE+L + + L P K H P P Sbjct: 119 IETRKKDRKNRREMLKRTSALQPAAPKPTHKKPVP 153 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,247,615 Number of Sequences: 5004 Number of extensions: 44701 Number of successful extensions: 107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 222442660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -