BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0580 (538 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069294-1|AAL39439.1| 292|Drosophila melanogaster GM14611p pro... 44 1e-04 AE014134-2153|AAF53161.1| 292|Drosophila melanogaster CG5325-PA... 44 1e-04 >AY069294-1|AAL39439.1| 292|Drosophila melanogaster GM14611p protein. Length = 292 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +1 Query: 1 NELDSDSEEVKRKRFEKVLELMQKMQDLGQPPTELVGDIG 120 +E DS VKR++F VL+ M+K+QD GQPP E++ + G Sbjct: 229 SEKTEDSAAVKREKFRVVLDDMRKLQDYGQPPPEILAETG 268 >AE014134-2153|AAF53161.1| 292|Drosophila melanogaster CG5325-PA, isoform A protein. Length = 292 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +1 Query: 1 NELDSDSEEVKRKRFEKVLELMQKMQDLGQPPTELVGDIG 120 +E DS VKR++F VL+ M+K+QD GQPP E++ + G Sbjct: 229 SEKTEDSAAVKREKFRVVLDDMRKLQDYGQPPPEILAETG 268 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,037,974 Number of Sequences: 53049 Number of extensions: 498363 Number of successful extensions: 1173 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1173 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -