BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0580 (538 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 22 3.5 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 22 3.5 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 22 3.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 6.0 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 25 EVKRKRFEKVLELMQKMQDLGQPPTELVGDIG 120 ++++ RF+K+ E M+ ++ PP + GD G Sbjct: 312 QMRKNRFQKIAESMKTARENPGPP-GVPGDHG 342 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 25 EVKRKRFEKVLELMQKMQDLGQPPTELVGDIG 120 ++++ RF+K+ E M+ ++ PP + GD G Sbjct: 312 QMRKNRFQKIAESMKTARENPGPP-GVPGDHG 342 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.2 bits (45), Expect = 3.5 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 25 EVKRKRFEKVLELMQKMQDLGQPPTELVGDIG 120 ++++ RF+K+ E M+ ++ PP + GD G Sbjct: 251 QMRKNRFQKIAESMKTARENPGPP-GVPGDHG 281 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 513 HFAGNFYQKEITY 475 HFAGNF IT+ Sbjct: 213 HFAGNFSSISITF 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,827 Number of Sequences: 438 Number of extensions: 2665 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -