BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0576 (656 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031632-2|CAA21005.2| 789|Caenorhabditis elegans Hypothetical ... 28 6.7 AF016428-3|AAO26000.3| 445|Caenorhabditis elegans Ground-like (... 27 8.9 >AL031632-2|CAA21005.2| 789|Caenorhabditis elegans Hypothetical protein Y32B12B.2 protein. Length = 789 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 315 HQQWEKKNNNSPKKRDQTHIEQNGEDSQQR 404 H++WEKKN D+ E+N +D + + Sbjct: 661 HKKWEKKNKVMIDSDDEEEEEENDDDKENQ 690 >AF016428-3|AAO26000.3| 445|Caenorhabditis elegans Ground-like (grd related) protein18 protein. Length = 445 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = -3 Query: 594 IKIPKVTEPSEFHKSMYSFDLKLW---NINVICVQHTLCKV 481 +++ T PS + +YS ++W N+NVIC +H+ V Sbjct: 382 MEMKMTTSPSISKQMIYSAATEMWMGRNVNVICSKHSFSYV 422 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,126,207 Number of Sequences: 27780 Number of extensions: 331600 Number of successful extensions: 932 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -