BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0574 (668 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 29 0.13 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 1.6 AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 24 5.0 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 24 5.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.6 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 23 8.7 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 29.1 bits (62), Expect = 0.13 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +3 Query: 93 DGQEAEYPQHVCDRPRRSRQVNPHGLVGFQGRYHCWCESRR 215 D A QH+ RP+RS + NP GR H C+SRR Sbjct: 273 DENPAGAQQHLSHRPQRSTRKNP------AGRQHDRCDSRR 307 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 172 LVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSL 285 +V + G++ G ET RK+ +R+ PL R L Sbjct: 804 MVLQEGVVEGGTKDETDMERERKEMVERSRPLRKRKRL 841 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 243 RTRPCITIKSTAISMFFELEEKDLVFI 323 ++ PC +K TA ++ EL EK++ + Sbjct: 13 KSPPCRAVKLTARALGIELVEKEMTLL 39 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 243 RTRPCITIKSTAISMFFELEEKDLVFI 323 ++ PC +K TA ++ EL EK++ + Sbjct: 13 KSPPCRAVKLTARALGIELVEKEMTLL 39 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 108 EYPQHVCDRPRRSRQVNPHGLVGFQG 185 ++P HVC+R R+ +N +V G Sbjct: 350 QHPLHVCERFERASVINREEIVRKHG 375 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 252 PCITIKSTAISMFFELEEKDLVFIT 326 PC ++ TA ++ ELE+K + +T Sbjct: 14 PCRAVELTAKALGLELEQKTINLLT 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,114 Number of Sequences: 2352 Number of extensions: 12899 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -