BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0574 (668 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 33 0.003 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 33 0.003 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 29 0.030 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.49 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 24 1.1 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 24 1.1 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 3.5 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 3.5 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 3.5 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 4.6 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 6.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.1 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 6.1 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 8.0 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.0 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 32.7 bits (71), Expect = 0.003 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 94 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446 + + +ID+PGH DF + D A+ Sbjct: 85 YYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 32.7 bits (71), Expect = 0.003 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 94 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446 + + +ID+PGH DF + D A+ Sbjct: 85 YYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 29.5 bits (63), Expect = 0.030 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +1 Query: 121 MSVIAHVDHGKSTLTDSL 174 ++++ HVDHGK+TL D+L Sbjct: 148 VTIMGHVDHGKTTLLDAL 165 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 351 EKGFLINLIDSPGHVDFSSEVTAALRVTD 437 E G + +D+PGH F S +TD Sbjct: 190 ESGERVTFLDTPGHAAFISMRHRGAHITD 218 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 25.4 bits (53), Expect = 0.49 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 118 NMSVIAHVDHGKSTLTDSL 174 N+ I HV HGKST+ ++ Sbjct: 44 NIGTIGHVAHGKSTIVKAI 62 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446 + + +ID+PGH DF + D A+ Sbjct: 12 YYVTIIDAPGHRDFIKNMITGTSQADCAV 40 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446 + + +ID+PGH DF + D A+ Sbjct: 28 YYVTIIDAPGHRDFIKNMITGTSQADCAV 56 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 164 RTRWFPRPVSLLVREPERPVSLTRVRTNKTVHHH*IYGHLY 286 R W R RE R + +NKT+H++ Y + Y Sbjct: 60 RETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNY 100 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 164 RTRWFPRPVSLLVREPERPVSLTRVRTNKTVHHH*IYGHLY 286 R W R RE R + +NKT+H++ Y + Y Sbjct: 60 RETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNY 100 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 164 RTRWFPRPVSLLVREPERPVSLTRVRTNKTVHHH*IYGHLY 286 R W R RE R + +NKT+H++ Y + Y Sbjct: 60 RETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNY 100 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 99 VHHPTDLVYREIHH 58 +HHP + R++HH Sbjct: 400 LHHPNCKINRKVHH 413 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 279 ISMFFELEEKDLVFITNPDQREKSEKGFLI 368 ++MF+ D+ I+N +Q + S GF I Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.1 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 193 IAGARAGETRFTDTRKDEQDRASPLNLRPSLCSSSLKRKI*YSS 324 + G AG+ T + +D SP L P+L S+++ + YSS Sbjct: 631 VCGVAAGDPPLTISWL--KDGQSPFPLPPNLASANISQLDPYSS 672 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 279 ISMFFELEEKDLVFITNPDQREKSEKGFLI 368 ++MF+ D+ I+N +Q + S GF I Sbjct: 527 LNMFYNNFNSDIKSISNNEQVKVSALGFFI 556 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 164 RTRWFPRPVSLLVREPERPVSLTRVRTNKTVHHH*IYGHLY 286 R W R RE R + +N+T+H++ Y + Y Sbjct: 60 RETWKERSRDRTERERSREPKIISSLSNRTIHNNNNYKYNY 100 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 8.0 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 255 CITIKSTAISMFF 293 C T+K +A+ M+F Sbjct: 688 CATVKGSAVDMYF 700 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 611 QYAGTSGIVLQLQVG 567 +Y SG+V+QLQ G Sbjct: 1549 EYGAVSGLVVQLQRG 1563 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,673 Number of Sequences: 438 Number of extensions: 3637 Number of successful extensions: 20 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -