BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0573 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30512| Best HMM Match : GLTT (HMM E-Value=0.00058) 29 4.4 SB_42415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 >SB_30512| Best HMM Match : GLTT (HMM E-Value=0.00058) Length = 1083 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 434 KSRLSSWLGVXGVAGLAAPPVTLRAVQSREQGHQDHHRGPAPR 306 +SRL + + V GL PP L ++ RE+ D + G APR Sbjct: 662 RSRLQDY--ILAVQGLL-PPEALESISGREKAAGDSNEGDAPR 701 >SB_42415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -3 Query: 482 ALLAKELELDHSRALSKSRLSSWLGVXGVAGL 387 ALLAK++ +H R L S WL V G GL Sbjct: 688 ALLAKQV-YEHERRLQSSATRRWLAVSGGIGL 718 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,075,021 Number of Sequences: 59808 Number of extensions: 308510 Number of successful extensions: 651 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -