BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0572 (615 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61840.1 68414.m06978 DC1 domain-containing protein similar t... 28 4.3 At2g29450.1 68415.m03578 glutathione S-transferase (103-1A) iden... 27 7.5 >At1g61840.1 68414.m06978 DC1 domain-containing protein similar to hypothetical protein GI:3184279 from [Arabidopsis thaliana]; contains Pfam profile PF03107: DC1 domain Length = 814 Score = 28.3 bits (60), Expect = 4.3 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -1 Query: 324 PNHIYNYNYL--NFSIQPCFCCGR 259 P H +YL N I CFCCGR Sbjct: 150 PEHSLQLSYLDLNARIMECFCCGR 173 >At2g29450.1 68415.m03578 glutathione S-transferase (103-1A) identical to Swiss-Prot:P46421 glutathione S-transferase 103-1A [Arabidopsis thaliana] Length = 224 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = -1 Query: 375 KKNTRNLEEIKAISDCWP---NHIYNYNYL 295 K+ RNLE+++ + DC P H+ + NY+ Sbjct: 188 KRWVRNLEKVEIVKDCVPPREEHVEHMNYM 217 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,493,839 Number of Sequences: 28952 Number of extensions: 213518 Number of successful extensions: 409 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -