BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0570 (845 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 4.0 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 4.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.3 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 7.0 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.6 bits (46), Expect = 4.0 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +1 Query: 211 VLFNV*VSVLYSGKFIVRLLFHLMFKRLLFRDLILHSDSNCTVS 342 +L NV V Y G+ + L K L L H+ SN TVS Sbjct: 93 ILKNV-FGVAYPGELLAILGSSGAGKTTLLNTLTFHTSSNLTVS 135 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.6 bits (46), Expect = 4.0 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +1 Query: 211 VLFNV*VSVLYSGKFIVRLLFHLMFKRLLFRDLILHSDSNCTVS 342 +L NV V Y G+ + L K L L H+ SN TVS Sbjct: 93 ILKNV-FGVAYPGELLAILGSSGAGKTTLLNTLTFHTSSNLTVS 135 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 236 TETYTLNRTSAAAADS 189 TET+T NRT +A ++S Sbjct: 1001 TETHTNNRTHSATSNS 1016 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 46 QIDLEYDPLKIRAPAQSQAGPGGP 117 Q + YD K++A A +Q G GP Sbjct: 130 QTQVVYDSCKLQAAAVTQNGVLGP 153 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,496 Number of Sequences: 336 Number of extensions: 3738 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -