BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0570 (845 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 4.7 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 4.7 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 8.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 8.2 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 627 DGERHLLGPDRAHPTIACNHSQN 695 +G +GP HPT A HS++ Sbjct: 1753 NGHSGTMGPPVGHPTNASAHSRS 1775 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.6 bits (46), Expect = 4.7 Identities = 17/72 (23%), Positives = 31/72 (43%) Frame = -1 Query: 371 EAFDLTLGARDTVQLESECKIKSRKSSRLNIK*KSNLTINLPLYNTETYTLNRTSAAAAD 192 E + LGA + ES +S + N++ + N + +Y T +Y + + D Sbjct: 82 EVVAVALGALLSKGEESFPTARSLEKLLCNVEAEENYNLLEDIYETLSYDCDVDVSTFFD 141 Query: 191 SLRCAVLYRYCL 156 L V+Y C+ Sbjct: 142 QLGQEVIYTACV 153 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 491 RHVNITGFNMGNK*SSTNKVS 429 RH +I GFN+G + +S++ S Sbjct: 1035 RHGDIQGFNVGYRETSSSNPS 1055 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 491 RHVNITGFNMGNK*SSTNKVS 429 RH +I GFN+G + +S++ S Sbjct: 1031 RHGDIQGFNVGYRETSSSNPS 1051 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,123 Number of Sequences: 438 Number of extensions: 4633 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -