BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0569 (617 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 24 0.89 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 2.1 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 6.3 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 8.3 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.3 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 24.2 bits (50), Expect = 0.89 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 255 FELTGIPPAPXGVPQIEVTFDIDANGILNVSAIEKSTNK 371 + G+ A V I+ D+D NG N + ++K+ K Sbjct: 56 YSFIGVNDADWSVLVIDPELDVDQNGFRNFTNLKKTHPK 94 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 2.1 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 457 ETRMTSKRRPSRPRMHWILLLQHEVYHGG*EAPGKDF*L*QAXHPR 594 + + +S ++PS +L L+H V H G ++P + + HP+ Sbjct: 77 QNQPSSYKQPSSDMADVLLSLKHAVVHPG-QSPAEKYDQQHLYHPQ 121 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 521 SMKSTMEDEKLQGKISDSD 577 S+ S EDE+++ ++SD D Sbjct: 18 SLLSKKEDEEVEHRLSDRD 36 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 442 RQRSTETRMTSKRRPSRPRMHWILL 516 R+RST ++ T +RPR + L Sbjct: 43 RKRSTSSQSTEGENDARPRASQVKL 67 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 8.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 249 EQVVIFGHSTLTLKYLDEYSGLV 181 +QV F HS ++ +L E GLV Sbjct: 367 QQVKNFRHSVRSVFFLSEIFGLV 389 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,819 Number of Sequences: 336 Number of extensions: 2452 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -