BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0569 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 26 1.1 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.1 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 25 1.5 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 3.4 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 3.4 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 6.0 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 6.0 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 23 6.0 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 23 6.0 AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 23 6.0 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 7.9 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.9 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.9 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.9 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 7.9 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.9 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.9 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 326 QRYPQRFRYREVHQQGEQDHHYQRQR 403 QR PQR+ QQ +Q H Q+Q+ Sbjct: 354 QRQPQRYVVAGSSQQQQQQHQQQQQK 379 Score = 23.0 bits (47), Expect = 7.9 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +2 Query: 314 RHRCQRYPQRFRYR-EVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQKRG*QAKGDHP 490 + R Q+ QR + + + HQ+ +Q QRQ+ Q + + R Q Q + + P Sbjct: 270 QQREQQQQQRVQQQNQQHQRQQQQQQQQRQQQQQQEQQELWTTVVRRRQNTQQQQQSNQP 329 Query: 491 GQE 499 Q+ Sbjct: 330 QQQ 332 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 311 LRHRCQRYPQRFRYREVHQQGEQDHHYQRQRS 406 L+ + Q+ Q+ + + HQQ + HH+Q Q S Sbjct: 1308 LQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLS 1339 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 393 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQ 491 N++ R +EE ++M NE+ K + QK+ Q Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQ 236 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 24.2 bits (50), Expect = 3.4 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 282 PXGVPQIEVTFDIDANGILNVSAIEKSTNKE--NKITITNDKGRLS 413 P G + T+D+ +G+LN A+ N + I I D G L+ Sbjct: 255 PDGFMALVDTYDVKRSGLLNFCAVALGLNDQGYRAIGIRIDSGDLA 300 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +3 Query: 339 NVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNE 464 N+ A++K KI TN++ ++++ ++ EK +NE Sbjct: 1024 NMKAMQKLDRVTEKIQSTNEEFEAARKKAKKAKAAFEKVKNE 1065 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 326 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 412 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 326 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 412 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.4 bits (48), Expect = 6.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 326 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 412 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRQPQQFQQQQRQPQYLQPQQSQRQQEEL 216 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 23.4 bits (48), Expect = 6.0 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -3 Query: 573 ESEIFPWSFSSSMVDFMLKQ*DPMHSWPGWSPFACHPRFCTSL 445 + E+FP F +Q H + W+PF PR C L Sbjct: 406 DPEVFPNPEQFDPERFSPEQEAKRHPY-AWTPFGEGPRICVGL 447 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 23.4 bits (48), Expect = 6.0 Identities = 16/69 (23%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = +3 Query: 282 PXGVPQIEVTFDIDANGILNVSAIEK---STNKENKITITNDKGRLSKEEIERMVNEAEK 452 P G + ++ + ++GIL ++ K N+E I IT+ G+ K+ + E Sbjct: 65 PKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITH-TGQPMKQVTGKAAPENGH 123 Query: 453 YRNEDDKQK 479 + E +K + Sbjct: 124 SKKEGEKME 132 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 326 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 412 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRPPQQFQQQQRQPQYLQPQQLQRQQEEL 216 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 112 TTLIKRNTTIPTKQTHPFTTYSDNQP 189 TT +K TT P TT++ QP Sbjct: 131 TTTVKPTTTTPPPCPPTLTTFNGGQP 156 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 112 TTLIKRNTTIPTKQTHPFTTYSDNQP 189 TT +K TT P TT++ QP Sbjct: 131 TTTVKPTTTTPPPCPPTLTTFNGGQP 156 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 112 TTLIKRNTTIPTKQTHPFTTYSDNQP 189 TT +K TT P TT++ QP Sbjct: 131 TTTVKPTTTTPPPCPPTLTTFNGGQP 156 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 112 TTLIKRNTTIPTKQTHPFTTYSDNQP 189 TT +K TT P TT++ QP Sbjct: 129 TTTVKPTTTTPPPCPPTLTTFNGGQP 154 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 112 TTLIKRNTTIPTKQTHPFTTYSDNQP 189 TT +K TT P TT++ QP Sbjct: 131 TTTVKPTTTTPPPCPPTLTTFNGGQP 156 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 326 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 412 QR PQ F+ ++ Q Q QRQ+ L Sbjct: 260 QRQPQEFQQQQRQPQYLQPQQSQRQQEEL 288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,317 Number of Sequences: 2352 Number of extensions: 10930 Number of successful extensions: 52 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -