BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0568 (635 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) 154 5e-38 SB_25666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_30413| Best HMM Match : WSC (HMM E-Value=2.4) 28 7.3 SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) 28 7.3 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 28 7.3 SB_45792| Best HMM Match : RVT_1 (HMM E-Value=3.5e-26) 27 9.7 SB_42145| Best HMM Match : Candida_ALS (HMM E-Value=0.36) 27 9.7 SB_12713| Best HMM Match : TP2 (HMM E-Value=2.9) 27 9.7 >SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 154 bits (374), Expect = 5e-38 Identities = 73/84 (86%), Positives = 79/84 (94%) Frame = +3 Query: 255 LVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQ 434 LVRIGVLDE + KLDYVLGL+IEDFLERRLQTQVFK GLAKSIHHAR+LIRQRHIRVRKQ Sbjct: 78 LVRIGVLDESRKKLDYVLGLRIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQ 137 Query: 435 VVNIPSFIVRLDSGKHIDFSLKSP 506 +VN+PSF+VRLDS KHIDFSL SP Sbjct: 138 LVNVPSFVVRLDSQKHIDFSLNSP 161 Score = 138 bits (334), Expect = 3e-33 Identities = 66/73 (90%), Positives = 69/73 (94%) Frame = +1 Query: 37 VFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKD 216 V SKTY TPRRPFEK RL+QELKIIGEYGLRNKREVWRVK TLA+IRKAARELLTLEEKD Sbjct: 5 VCSKTYTTPRRPFEKERLNQELKIIGEYGLRNKREVWRVKLTLAKIRKAARELLTLEEKD 64 Query: 217 PKRLFEGNALLRR 255 P+RLFEGNALLRR Sbjct: 65 PRRLFEGNALLRR 77 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = +2 Query: 509 GGGRPGRVKRKNLRKGQGG 565 GGGRPGRVKRKN++KGQGG Sbjct: 163 GGGRPGRVKRKNMKKGQGG 181 >SB_25666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.26 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = +1 Query: 64 RRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPK 222 +RP K L Q+ +G+YG KR+ V AARE+L +E PK Sbjct: 57 KRPLGKELLSQQFSDVGKYGRIYKRKFPTVNIVDIADPSAAREVLGIETLGPK 109 >SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/69 (27%), Positives = 33/69 (47%) Frame = +3 Query: 255 LVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQ 434 L +G++ K+ L + F RRL + +A+ + A I Q H+RV + Sbjct: 82 LHNMGLISTKK-NLGQCNKVNASSFCRRRLPVVMVNLKMAQVVKDAVKYIEQGHVRVGPE 140 Query: 435 VVNIPSFIV 461 V+ P+F+V Sbjct: 141 VIMDPAFLV 149 >SB_30413| Best HMM Match : WSC (HMM E-Value=2.4) Length = 259 Score = 27.9 bits (59), Expect = 7.3 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 444 CSQLACGHEYAFAGSKFWHDGWTSP 370 C++LA Y++ G +FW + W+ P Sbjct: 72 CARLAEQKNYSYFGVQFWGECWSGP 96 >SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) Length = 454 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +1 Query: 79 KARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPK 222 K L Q+ +G+YG KR+ V AARE+L +E PK Sbjct: 2 KELLSQQFSDVGKYGRIYKRKFPTVNIVDIADPSAAREVLGIETLGPK 49 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +3 Query: 255 LVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARIL 401 L++I D+K M+ +Y+LGL +E +R +++ + K H R L Sbjct: 806 LLQILTQDDKNMEAEYLLGLILERQGKRLEAMKLYMDVIRKDTSHVRAL 854 >SB_45792| Best HMM Match : RVT_1 (HMM E-Value=3.5e-26) Length = 600 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -1 Query: 446 DVHNLLADTNMPLPDQNSGMMDGLRQASFEHLRLQTTLQEVLN 318 D+ + A MP P +G+ D + Q +FE +++ T VL+ Sbjct: 381 DLEKVKAICEMPQPVDIAGVQDLIAQEAFEKIKMMITKAPVLH 423 >SB_42145| Best HMM Match : Candida_ALS (HMM E-Value=0.36) Length = 542 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 266 WSTG*KTDETRLCAWSED*GLLGASSADAGVQSWP 370 WS G KT+ET + W G +A+ + WP Sbjct: 298 WSNGFKTEETAITTWPN-----GFKTAETTITRWP 327 >SB_12713| Best HMM Match : TP2 (HMM E-Value=2.9) Length = 349 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 505 HWWRSSWTCQEEEPPQGTGWRSAN 576 HWW+ + CQ P G RS N Sbjct: 32 HWWKCNGPCQNRPPFYGVVKRSMN 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,113,945 Number of Sequences: 59808 Number of extensions: 400657 Number of successful extensions: 1038 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -