BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0568 (635 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 2.5 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 2.5 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 2.5 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 2.5 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.3 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 98 SWSRRAFSKGRRGVTYVFENTDGTL 24 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 98 SWSRRAFSKGRRGVTYVFENTDGTL 24 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 98 SWSRRAFSKGRRGVTYVFENTDGTL 24 S++ + S + +TYV++N +GTL Sbjct: 252 SFAIESISYEQTAITYVWKNDEGTL 276 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 98 SWSRRAFSKGRRGVTYVFENTDGTL 24 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 335 LQEVLNLQTKHIIEFHLFFIQYSNTNQRRR 246 ++ V N+ K + F L F+Q N N++ + Sbjct: 42 IRPVQNMTEKVHVNFGLAFVQLINVNEKNQ 71 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,264 Number of Sequences: 438 Number of extensions: 3397 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -