BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0566 (474 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0112 - 17375871-17376099,17377021-17377054,17377237-173774... 27 5.8 02_02_0357 + 9360108-9360754,9363732-9364137 27 7.7 02_02_0355 + 9312814-9313650 27 7.7 >03_04_0112 - 17375871-17376099,17377021-17377054,17377237-17377470, 17377636-17377705 Length = 188 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 109 SAGLDPEDPDFSGCFFGXSPAARG 38 +A L DP FSGC F S +A G Sbjct: 93 AATLSSSDPSFSGCTFPSSASAAG 116 >02_02_0357 + 9360108-9360754,9363732-9364137 Length = 350 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 105 RVWTRRTRISRVASSVHRLQPGGSTSSRAXRHRGR 1 R WT TR R AS + PG R R R R Sbjct: 124 RYWTPTTRPLRRASGEEEVMPGKEAMPRCRRRRRR 158 >02_02_0355 + 9312814-9313650 Length = 278 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 105 RVWTRRTRISRVASSVHRLQPGGSTSSRAXRHRGR 1 R WT TR R AS + PG R R R R Sbjct: 144 RYWTPTTRPLRRASGEEEVMPGKEAMPRCRRRRRR 178 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.310 0.116 0.300 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,537,250 Number of Sequences: 37544 Number of extensions: 71149 Number of successful extensions: 152 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -