BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= e96h0566
(474 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical prote... 29 0.11
>AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical protein
protein.
Length = 195
Score = 28.7 bits (61), Expect = 0.11
Identities = 16/46 (34%), Positives = 22/46 (47%)
Frame = -1
Query: 162 LPQP*ELQPVFWLLPVSFPRVWTRRTRISRVASSVHRLQPGGSTSS 25
L QP P+FW LP SFP + T ++ + + G S SS
Sbjct: 17 LLQPLLAAPIFWFLPWSFPALSPTTTTLATTSGTA--ASSGASNSS 60
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.310 0.116 0.300
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,174
Number of Sequences: 2352
Number of extensions: 2243
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 41670678
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
- SilkBase 1999-2023 -