BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0559 (636 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.05c |mug182||YjeF family protein|Schizosaccharomyces p... 57 2e-09 SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |S... 29 0.56 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 27 1.7 SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 27 3.0 >SPAC15A10.05c |mug182||YjeF family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 242 Score = 56.8 bits (131), Expect = 2e-09 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +3 Query: 519 FSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPG 629 FS+DQLMELAGLSV+ A+ + +PPS +S LI CGPG Sbjct: 24 FSIDQLMELAGLSVSQAVYREYPPSQYSQVLICCGPG 60 >SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |Schizosaccharomyces pombe|chr 2|||Manual Length = 1944 Score = 29.1 bits (62), Expect = 0.56 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 203 LRRFFYCFSFTN-NRYVVWFQMSVKIIFYLNPMCML 99 +R + FSF N N Y+VWF+ + L P C++ Sbjct: 56 VRECLFLFSFQNDNEYLVWFKKHLNERLQLCPKCIV 91 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 27.5 bits (58), Expect = 1.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 490 VLPLLTD*GTASQCCIDSYCSS*FRCYT 407 VLP LT+ G S C C S ++CY+ Sbjct: 394 VLPFLTNGGCYSYICRSRSCPSKYQCYS 421 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 26.6 bits (56), Expect = 3.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 105 HVTYIGRYHRLYT*WY 58 H TYIGR+H+ + W+ Sbjct: 430 HNTYIGRWHKFFQGWF 445 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,491,541 Number of Sequences: 5004 Number of extensions: 49928 Number of successful extensions: 98 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -