BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0559 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0182 - 11552540-11552606,11552692-11552787,11553458-115535... 56 2e-08 05_01_0315 - 2468267-2468293,2469021-2469070,2469159-2469234,246... 30 1.3 03_05_0559 - 25610474-25610951,25611149-25611890,25612355-256127... 29 3.1 01_06_0575 - 30357556-30357582,30357698-30357944,30358039-303581... 29 4.1 03_02_0915 + 12360079-12360095,12360225-12361353 27 9.4 >10_06_0182 - 11552540-11552606,11552692-11552787,11553458-11553528, 11553660-11553764,11554149-11554239,11554331-11554381, 11554478-11554566,11554667-11554909,11555027-11555190, 11555883-11555988,11556075-11556242,11557456-11557494, 11557582-11557713 Length = 473 Score = 56.4 bits (130), Expect = 2e-08 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +3 Query: 519 FSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPG 629 FSVDQLMELAGLSVA+A+A+V+ H+ L++CGPG Sbjct: 38 FSVDQLMELAGLSVAAAVAEVYKLGEHTRVLVICGPG 74 >05_01_0315 - 2468267-2468293,2469021-2469070,2469159-2469234, 2469498-2469575,2469967-2470048,2470146-2470238, 2470564-2470673,2470831-2470893,2471293-2471344, 2471421-2471545,2472681-2472794,2472917-2472961, 2473278-2473337,2474725-2474778,2474944-2474992, 2475071-2475252,2475349-2475404,2475491-2475584 Length = 469 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = -2 Query: 188 YCFSFTNN-RYVVWFQMSVKIIFYLNPMCM-LPI*VGIIDYTLNGMICIIMYYSLIYIFT 15 YC+S +VW +SV + YL+ C+ + + +I+Y++ + + Y S+ ++F Sbjct: 83 YCYSLKGRGASLVWLLLSVTYLCYLHGACVSFILLIALINYSI-VKVLEVAYLSIEHMFV 141 Query: 14 NCH 6 + H Sbjct: 142 DVH 144 >03_05_0559 - 25610474-25610951,25611149-25611890,25612355-25612744, 25613041-25613099,25613186-25613326,25613449-25613545, 25614999-25615185 Length = 697 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -3 Query: 481 LLTD*GTASQCCIDSYCSS*FRCYTVLLHATTKCLINVTYCALSYIDN 338 ++ D S+CC DS+C R Y + +KC+ V A I N Sbjct: 273 VMADAVLTSKCCFDSFCDKCIRDYII---TQSKCICGVKVLADDLIPN 317 >01_06_0575 - 30357556-30357582,30357698-30357944,30358039-30358161, 30358275-30358301,30358475-30358633,30359764-30359948, 30360225-30360293,30360432-30362354,30363018-30363339, 30363506-30363543 Length = 1039 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +3 Query: 435 YESMQHCDAVPQSVRSGSTGPGSFHEYKFSVDQLMELAGLSVASAIAKVFPPSTHSS 605 Y+S+ D++P S +G+ F E + SVD L+ S +K+ P T +S Sbjct: 480 YKSIPSQDSIPTSGLNGTFASNLFRESRKSVDTCTSLSKEDQCSWYSKLHPVCTPAS 536 >03_02_0915 + 12360079-12360095,12360225-12361353 Length = 381 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -3 Query: 460 ASQCCIDSYCSS*FRCYTVLLHATTKCLINVTYCALSYIDNLGMMT 323 AS+CC DS+C RC + A ++C A I N + T Sbjct: 187 ASKCCFDSFCD---RCIRDHIAAKSRCACGAQARAGDLIPNTTLRT 229 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,088,644 Number of Sequences: 37544 Number of extensions: 284841 Number of successful extensions: 464 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -