BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0559 (636 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.5 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.6 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.0 bits (47), Expect = 2.5 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -3 Query: 379 LINVTYCALS---YIDNLGMMTYFTDHVYLNVYINYKRYIL 266 ++N Y + + Y D + YF + V LN Y Y R +L Sbjct: 201 IVNTNYSSKNMREYNDPEYKLDYFMEDVELNAYYYYMREML 241 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 379 LINVTYCAL---SYIDNLGMMTYFTDHVYLNVYINYKRYIL 266 ++N Y + Y D + YF + V LN Y Y R +L Sbjct: 201 IVNTNYSSKYMREYNDPEYKLDYFMEDVELNAYYYYMREML 241 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 4.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 286 LYKHLNIRDP*SKSSCQDYQCNLEH 360 LY H + P + C+DYQ L+H Sbjct: 277 LYGHGVCKWPGCEVICEDYQAFLKH 301 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 298 LNIRDP*SKSSCQDYQCNLEHNM 366 L+IRD + + YQC +H + Sbjct: 165 LHIRDVGPEDGYKTYQCRTKHRL 187 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,938 Number of Sequences: 438 Number of extensions: 3967 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -