BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0558 (540 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30C2.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 4.1 SPAC17C9.06 |sam50||SAM complex subunit Sam50 |Schizosaccharomyc... 25 7.2 >SPAC30C2.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 25.8 bits (54), Expect = 4.1 Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +1 Query: 37 PRRKYTNSGSWSYPTPRCSETPIRL--KPGERSI 132 P ++ N+ S+ +P S+TPIRL + G++S+ Sbjct: 70 PFHEFLNNRSYRFPKLDYSQTPIRLAIRSGKKSV 103 >SPAC17C9.06 |sam50||SAM complex subunit Sam50 |Schizosaccharomyces pombe|chr 1|||Manual Length = 475 Score = 25.0 bits (52), Expect = 7.2 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 491 VNLKIIKVSGALVSLNAK*FXICDRNVSEGS 399 V+L + GAL SLN K +CDR + GS Sbjct: 324 VSLSLSARIGALHSLNKKQVSLCDRFMLGGS 354 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,017,344 Number of Sequences: 5004 Number of extensions: 37160 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -