BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0553 (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 26 1.1 DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 24 5.9 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 26.2 bits (55), Expect = 1.1 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 351 ARVTLPWHHYSWTFSSSSNCRIQ 283 AR HH W + ++NC+I+ Sbjct: 69 ARAINALHHIDWVYKHTNNCKIE 91 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 23.8 bits (49), Expect = 5.9 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 Query: 271 CKIHLDPTIAAAGEGPAIMMPWQGDPSNMIDRFDVRAHLDCIPE 402 CK+ P AA+G +++P+ G I AHL I E Sbjct: 233 CKVVDMPFDAASGLSMLVLLPYDGTELRQIVNSITPAHLAQIDE 276 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,846 Number of Sequences: 2352 Number of extensions: 14526 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -