BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0549 (777 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39440.1 68417.m05581 expressed protein ; expression support... 29 3.4 At3g63160.1 68416.m07093 expressed protein 28 6.0 >At4g39440.1 68417.m05581 expressed protein ; expression supported by MPSS Length = 443 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 343 NTPSYNSMYSVFILYNMTYNLLDVLRYKISHMLLVLKN 230 N + N+++ +FI Y YNL ++L + H LVL N Sbjct: 176 NVDTLNAVHKLFIHYCTQYNLPNLLDLYLDHHELVLDN 213 >At3g63160.1 68416.m07093 expressed protein Length = 69 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = -3 Query: 451 KNKTSTVTVLTLSIAIL-LTLVIKPIFKKI 365 K +T+TV V L++ L + LV KP+FKK+ Sbjct: 20 KKQTATVVVGVLAVGWLAIELVFKPLFKKL 49 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,357,008 Number of Sequences: 28952 Number of extensions: 227410 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -