BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0546 (668 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68780.1 68414.m07862 leucine-rich repeat family protein cont... 33 0.17 At5g03890.1 68418.m00365 hypothetical protein 30 1.6 At2g22795.1 68415.m02704 expressed protein 29 2.8 At3g22421.1 68416.m02831 F-box family protein contains Pfam PF00... 29 3.7 At2g18500.1 68415.m02156 ovate family protein 69% similar to ova... 29 3.7 At1g21160.1 68414.m02646 eukaryotic translation initiation facto... 29 3.7 At5g60810.1 68418.m07629 hypothetical protein 28 4.9 At5g16060.1 68418.m01877 expressed protein 28 4.9 At3g53150.1 68416.m05857 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.5 At3g48830.1 68416.m05333 polynucleotide adenylyltransferase fami... 27 8.5 At3g23990.1 68416.m03013 chaperonin (CPN60) (HSP60) identical to... 27 8.5 At1g02060.1 68414.m00126 pentatricopeptide (PPR) repeat-containi... 27 8.5 >At1g68780.1 68414.m07862 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 432 Score = 33.1 bits (72), Expect = 0.17 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +2 Query: 242 KENSITCSQGPSITKNVTFQKRKKAQKLF*NPATNQTMNTNLKEESWLMLWLCIKR-QTK 418 K+NS+ CS+ P I + K K+ LF T ++ +E WL L ++R + + Sbjct: 96 KDNSLACSESPVIRPQLFELKHLKSLSLFNCFTTPNRYLASISDEKWLDLSKSLERLEIR 155 Query: 419 SLP*VLG 439 S P ++G Sbjct: 156 SNPGLIG 162 >At5g03890.1 68418.m00365 hypothetical protein Length = 179 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 391 VVVHKETNEKSSLSSRLKEMLQKAVNREPLKTSLDDKKVE 510 +VVHK+ EK + EM+ + + ++ L TS DD +E Sbjct: 119 IVVHKQELEKLLQGGSVHEMMYQTLEKQLLLTSSDDDDLE 158 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 4/67 (5%) Frame = +1 Query: 328 LESSDESDDEYKFKRRKLADAVVVHKET----NEKSSLSSRLKEMLQKAVNREPLKTSLD 495 LE + E +DE K K + KET NE+SS K+ + + +E + + Sbjct: 498 LEETKEKEDETKEKEESSSQEKTEEKETETKDNEESSSQEETKDKENEKIEKEEASSQEE 557 Query: 496 DKKVEVQ 516 K+ E + Sbjct: 558 SKENETE 564 >At3g22421.1 68416.m02831 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 426 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +2 Query: 173 TPQSHFAKEPKQKAKSRRRLKKHKENSITCSQGPSITKNVTFQKRKKAQK 322 T SH E + SR LK + +TC S+ KN +F K + A K Sbjct: 3 TTISHLPTELLDEIISRVPLKSTRAVRLTCKNWDSLFKNRSFMKEEAAAK 52 >At2g18500.1 68415.m02156 ovate family protein 69% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 315 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 140 ISASETEENYCTPQSHFAKEPKQKAKSRRRLKKHKENS 253 + A TEE Y TP+ +K RR KK K NS Sbjct: 104 VIAQVTEEEYETPRRKIYNGGSEKDNRRRLKKKEKSNS 141 >At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to SP|O60841 Translation initiation factor IF-2 {Homo sapiens}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03144: Elongation factor Tu domain 2 Length = 1088 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 191 AKEPKQKAKSRRRLKKHKENSITCSQGPSITKNVTFQKR 307 A+E +QK K R+ KK + +T Q KN F+KR Sbjct: 264 AEEIRQKRKIRKMEKKQEGLILTAKQKRDAAKNEAFRKR 302 >At5g60810.1 68418.m07629 hypothetical protein Length = 83 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 367 KRRKLADAVVVHKETNEKSSLSSRLKEMLQKAVNREPL 480 + RK V V E NEK+ L KEM++K N++ L Sbjct: 25 ENRKTLKHVNVKVEANEKNGLEIESKEMVKKRKNKKRL 62 >At5g16060.1 68418.m01877 expressed protein Length = 95 Score = 28.3 bits (60), Expect = 4.9 Identities = 21/75 (28%), Positives = 35/75 (46%) Frame = +2 Query: 152 ETEENYCTPQSHFAKEPKQKAKSRRRLKKHKENSITCSQGPSITKNVTFQKRKKAQKLF* 331 + EN+ + A K KAK+ ++ C+ G T +V + RK+A++L Sbjct: 7 QARENHVKKKVEEALRSKMKAKALMECDQYVSKYAQCATGR--TFSVVWTCRKQAREL-- 62 Query: 332 NPATNQTMNTNLKEE 376 N +Q N N+ EE Sbjct: 63 NTCLHQFTNDNVLEE 77 >At3g53150.1 68416.m05857 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 507 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Frame = +1 Query: 340 DESDDEYKF--KRRKLAD-AVVVHKETNEKSSLSSRLKEMLQKAVNR 471 DE+DD+ +F +RR++ + AV+ K EK S S + ++Q + + Sbjct: 457 DENDDDNEFVRRRRRIQELAVMAKKAVEEKGSSSINVSILIQDVLEQ 503 >At3g48830.1 68416.m05333 polynucleotide adenylyltransferase family protein / RNA recognition motif (RRM)-containing protein similar to SP|P13685 Poly(A) polymerase (EC 2.7.7.19) {Escherichia coli O157:H7}; contains Pfam profiles PF01743: polyA polymerase family protein, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 881 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 176 PQSHFAKEPKQKAKSRRRLKKHKENS 253 P+ +EP+ +++ LKKHKENS Sbjct: 481 PKQDSKREPEDDLETKPILKKHKENS 506 >At3g23990.1 68416.m03013 chaperonin (CPN60) (HSP60) identical to SWISS-PROT:P29197- chaperonin CPN60, mitochondrial precursor (HSP60) [Arabidopsis thaliana] Length = 577 Score = 27.5 bits (58), Expect = 8.5 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +1 Query: 328 LESSDESDDEYKFKRRKLADAVVVHKETNEKSSLSSRLKEMLQKAVNREPLKTSLDDKKV 507 L+ S+ E K+ ++ DA+ K E+ L +L A E L T+ D+K+ Sbjct: 409 LKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELEKLPTANFDQKI 468 Query: 508 EVQIIK 525 VQII+ Sbjct: 469 GVQIIQ 474 >At1g02060.1 68414.m00126 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 710 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 403 KETNEKSSLSSRLKEMLQKAVNREPLKTSLD 495 K TNE+ S S+L L +AVN P L+ Sbjct: 24 KVTNEERSTKSKLARSLARAVNSNPWSDELE 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,429,629 Number of Sequences: 28952 Number of extensions: 221825 Number of successful extensions: 742 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -