BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0541 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0034 + 8431753-8431790,8431940-8432063,8432726-8433038,843... 29 4.5 07_03_1396 - 26259614-26259739,26259853-26259939,26260032-262604... 28 7.9 >10_05_0034 + 8431753-8431790,8431940-8432063,8432726-8433038, 8433189-8433251,8433778-8434058 Length = 272 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 413 FLAAGWSGFIGDICSLRPKSCIIFSVLSPVT 321 +++ GW F+ ++ LR C+ FSV SP T Sbjct: 94 YISKGWKKFV-ELTDLRVGQCVRFSVSSPST 123 >07_03_1396 - 26259614-26259739,26259853-26259939,26260032-26260409, 26260497-26260692,26260794-26261032,26261132-26261272 Length = 388 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 622 SWVKCISAISFPNLLSRSYKS 560 SW+ CIS ISF LLS + S Sbjct: 202 SWIDCISNISFEELLSEAAPS 222 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,421,462 Number of Sequences: 37544 Number of extensions: 284000 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -