BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0539 (668 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 4.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.1 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 21 8.0 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 413 FDIARNKSLEVLESMKIPIEIARE 484 F AR ++ V E ++PIEI R+ Sbjct: 161 FSRAREEANVVPEGARVPIEIPRD 184 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 464 PIEIARENLVDVARTHSKLRSTQAWADVLTDACVDAV 574 P E+ NL R H +T A + T+ VDA+ Sbjct: 430 PRELEAVNLGSACRIHGSPATTAAPPQLPTEESVDAL 466 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 575 LTIRTPGKPVDLHMGEIMGDETQDGY 652 L IR PG+P H G G E ++G+ Sbjct: 78 LNIR-PGQPSRQHAGFEFGKEYKNGF 102 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,369 Number of Sequences: 438 Number of extensions: 3102 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -