BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0538 (536 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 24 0.98 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.0 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 5.2 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 5.2 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 9.1 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 21 9.1 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.8 bits (49), Expect = 0.98 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 223 FQPLLLCIRQHACQDQCRLF 164 F +L + +HAC + CR+F Sbjct: 266 FNTVLELMPKHACSEYCRVF 285 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.0 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 33 AGHSRQISTYSSYHEYEHRWQTQGY-VCDDGYQRCWP 140 AG + + + +Y+E H +TQG+ V D +R P Sbjct: 1667 AGEYTRAAGFLAYYEICHNIKTQGWTVVQDPNRRMGP 1703 Score = 21.4 bits (43), Expect = 5.2 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +3 Query: 15 KLNQNVAGHSRQISTYSSYHEYEHRWQTQGYVCDDGYQRCW 137 +L N A +R I + E +W G D Y +CW Sbjct: 1488 RLVNNPAARARFIKHVLQFLE---KWNFDGLDLDWEYPKCW 1525 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.4 bits (43), Expect = 5.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 45 RQISTYSSYHEYEHRWQTQGYVCDDG 122 RQ+ + +H+ QT G DDG Sbjct: 46 RQVKVWFQNRRMKHKRQTLGKQGDDG 71 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.4 bits (43), Expect = 5.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 45 RQISTYSSYHEYEHRWQTQGYVCDDG 122 RQ+ + +H+ QT G DDG Sbjct: 177 RQVKVWFQNRRMKHKRQTLGKQGDDG 202 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 20.6 bits (41), Expect = 9.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 297 QYPFAYLGTSLVSY 256 Q P+ Y GT+ VSY Sbjct: 303 QVPYKYDGTNWVSY 316 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 20.6 bits (41), Expect = 9.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 166 KADIDLDKRAGECTEEEVEK 225 K DI DK+A + EVEK Sbjct: 77 KKDIRADKKALQKLRREVEK 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,126 Number of Sequences: 336 Number of extensions: 2647 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -