BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0525 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 4e-33 SB_13062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_21771| Best HMM Match : TP2 (HMM E-Value=0.34) 29 3.9 SB_24194| Best HMM Match : RyR (HMM E-Value=5) 29 3.9 SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 138 bits (334), Expect = 4e-33 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +2 Query: 254 KASNILEDLETLRLFSRVVPEYCVQLTETEVLNQAFNLLFAFDEIVALGYRESVNLAQVR 433 K SNILEDLETLRLFSRV+PEYC + E+E+ AF L+FAFDEIVALGYRE+VNLAQ+R Sbjct: 543 KHSNILEDLETLRLFSRVIPEYCRAMEESEIGEHAFELIFAFDEIVALGYRENVNLAQIR 602 Query: 434 SFVEMDSHEEKIYQAVRQTQERE 502 +F EMDSHEEK++QAVRQTQERE Sbjct: 603 TFTEMDSHEEKVFQAVRQTQERE 625 Score = 124 bits (298), Expect = 1e-28 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 3/74 (4%) Frame = +3 Query: 45 VLIAATVCTKSGKALVSRQFVEMTKARIEGLLAAFPKLMTGG---RQHTFVETESVRYVY 215 VL+AA +CTK+GKA++SRQFVEMT++RIEGLL+AFPKLMT G +QHTFVETESVRYVY Sbjct: 470 VLLAAAICTKNGKAIISRQFVEMTRSRIEGLLSAFPKLMTSGSSVKQHTFVETESVRYVY 529 Query: 216 QPLDKLYMLLITTR 257 QPL+KLYMLLITT+ Sbjct: 530 QPLEKLYMLLITTK 543 >SB_13062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +3 Query: 96 RQFVEMTKARIEGLLAAFPKLMTGGRQHTFVETESVRYVYQPLDKLYML 242 R+ +E K R+E LL+ PK++ H ET+S ++ +D+L L Sbjct: 33 RRMLEGLKNRLEALLS--PKIVAAFNNHCLDETKSYVKIFTAIDRLDQL 79 >SB_21771| Best HMM Match : TP2 (HMM E-Value=0.34) Length = 1691 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -2 Query: 718 RSFMAERPTVRVSLAXVVXIFSAIDSDGDDEDIVELPKPL 599 RSF+ P ++ ++ + S DSD DD+D++ L PL Sbjct: 1107 RSFIMNTPDLKTNVKQIYGDLS--DSDFDDDDVILLESPL 1144 >SB_24194| Best HMM Match : RyR (HMM E-Value=5) Length = 211 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 451 LSRGKDLSSRKADPRTRGSDRMRERLRXCSVRDWRRPNVASRRAHR 588 + R + SRK + RG ++ + R C +RDW++ R A + Sbjct: 149 IERAHRVESRK---KARGDEQTKPRTIVCKLRDWKQREAVIREARK 191 >SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1207 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 502 LAFLGLPYGLINLFLVRVHFNKRTDL 425 L F G+PY ++N++LV V + + TD+ Sbjct: 103 LVFYGVPYLVVNMWLVIVTYLQHTDI 128 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 27.9 bits (59), Expect = 8.9 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = -3 Query: 420 RLTLSLYPRATISSKANSKLKAWFKTSVSVSCTQYSGTTLLKSLNV 283 +LTL+L + S +N KL++ K SVS+S S + K L V Sbjct: 605 KLTLNLEKTKCMLSGSNRKLESKIKLSVSISNYNVSNVSNFKYLGV 650 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,570,652 Number of Sequences: 59808 Number of extensions: 418570 Number of successful extensions: 3015 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3014 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -