BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0523 (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0043 + 19185969-19186036,19186205-19187342 28 9.4 01_05_0353 + 21278753-21278884,21279482-21279535,21279912-212799... 28 9.4 >02_04_0043 + 19185969-19186036,19186205-19187342 Length = 401 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 462 RCIVHRH*RW*SHQSCNVASNEGVFDASVDEYSKNPVRTAVISE 593 R ++RH RW S C ++S E FD S+ Y +N A + E Sbjct: 192 RAFIYRHGRWSSVSFCLLSSLEWAFD-SICTYLQNERLRAGLEE 234 >01_05_0353 + 21278753-21278884,21279482-21279535,21279912-21279991, 21280099-21280361,21280837-21280958 Length = 216 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -3 Query: 366 KRRYRFIHQRMGLYEVNDFIGKSPTV---LHARTGPGL 262 ++R R IH L+ V+D IGKS + +HAR G G+ Sbjct: 33 QQRGRLIHAHDILHNVDDNIGKSRRIIGAMHARFGLGI 70 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,293,459 Number of Sequences: 37544 Number of extensions: 418739 Number of successful extensions: 936 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -