BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0523 (767 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 27 0.19 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.5 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 27.1 bits (57), Expect = 0.19 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -3 Query: 510 YSFDDST--IVSADVQYIVFVSIHCLNLRMNGNSGKSVLQTDSNQ 382 ++FDD I+ A+V+ ++ + HC+N N N + Q D+NQ Sbjct: 391 FNFDDVNFRILGANVKELIR-NTHCVNNNQNDNIQNTNNQNDNNQ 434 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = -1 Query: 578 GPHRIFAILIYARVKNAFVRGNITALMTLPSSVPMYNTSYLF 453 GP + +++ A V V GN+ ++ + + + N + +F Sbjct: 62 GPWILVTLIVLAIVNVMVVLGNVLVILAVYHTSKLRNVTNMF 103 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,758 Number of Sequences: 438 Number of extensions: 5078 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -