BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0520 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57096| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_1691| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_27833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_57096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 150 RIPDERFPSGGLASQPVAKGK--NR*LSKNMWPRG*YGAPH*PSERLTPGIL 299 R+P RFPSG L S+ + G+ +R L P G + PS RL G L Sbjct: 384 RLPSRRFPSGRLPSRRLPSGRLPSRQLPSGPLPSGRLPSGCLPSRRLPSGRL 435 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +3 Query: 150 RIPDERFPSGGLASQPVAKGK--NR*LSKNMWPRG*YGAPH*PSERLTPGIL 299 R+P R PSG L S+ + G+ +R L P G + PS RL G L Sbjct: 269 RLPSRRLPSGRLPSRRLPSGRLPSRRLPSGRLPSGRLPSGRLPSRRLPSGRL 320 >SB_1691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = -3 Query: 653 PTEPTSRHQIFAPKS-LKKN--KQLSILRSKLLCNKWGTP 543 PTEP +++ + + L KN K SILR L C K+G P Sbjct: 21 PTEPREENRLASQREQLAKNRAKIKSILRPLLFCAKYGLP 60 >SB_27833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +1 Query: 166 GSQVEDSPVSRLLKEK---TDD*VKICGREVDTVPRTDPPRGSLL 291 GS E+ P S + +++ +DD + + + TVPR P LL Sbjct: 75 GSSYEEEPTSSISEQEQDTSDDILSVSSHSITTVPRLSPDELKLL 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,164,130 Number of Sequences: 59808 Number of extensions: 398856 Number of successful extensions: 824 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -