BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0516 (553 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 54 5e-08 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 54 5e-08 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 45 4e-05 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 44 9e-05 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 43 2e-04 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 42 2e-04 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 42 3e-04 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 42 4e-04 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 42 4e-04 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 41 5e-04 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 40 0.001 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 40 0.001 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 40 0.001 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 40 0.001 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 40 0.001 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 40 0.001 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 39 0.003 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 39 0.003 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 39 0.003 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 39 0.003 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 38 0.003 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 38 0.003 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 38 0.003 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 38 0.003 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 38 0.003 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 38 0.004 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 38 0.004 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 38 0.004 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 38 0.006 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 37 0.008 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 37 0.008 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 37 0.008 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 37 0.008 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 37 0.008 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 37 0.008 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 37 0.008 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 37 0.008 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 37 0.008 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 37 0.010 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 37 0.010 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 37 0.010 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 36 0.014 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 36 0.014 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 36 0.014 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 36 0.018 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 36 0.018 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 36 0.018 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 36 0.018 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 36 0.024 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 36 0.024 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 35 0.031 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 35 0.042 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 35 0.042 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 35 0.042 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 35 0.042 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 35 0.042 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 34 0.055 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 34 0.055 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 34 0.055 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 34 0.055 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 34 0.055 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 34 0.073 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 34 0.073 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 34 0.073 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 33 0.096 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 33 0.096 At2g47310.1 68415.m05906 flowering time control protein-related ... 33 0.096 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 33 0.096 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 33 0.13 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 33 0.13 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 33 0.13 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 33 0.13 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 33 0.13 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 33 0.13 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 33 0.13 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 33 0.17 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 32 0.22 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 32 0.22 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 32 0.22 At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing ... 32 0.29 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 32 0.29 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 32 0.29 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 32 0.29 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 31 0.39 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 31 0.39 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 31 0.39 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 0.39 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 31 0.39 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 31 0.39 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 31 0.39 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 31 0.39 At5g51300.2 68418.m06360 splicing factor-related contains simila... 31 0.51 At5g51300.1 68418.m06359 splicing factor-related contains simila... 31 0.51 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 31 0.51 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 31 0.51 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 31 0.68 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 0.68 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 30 0.89 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 30 0.89 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 30 0.89 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 30 0.89 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 30 0.89 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 30 0.89 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 30 0.89 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 30 0.89 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 30 1.2 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 30 1.2 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 30 1.2 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 30 1.2 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 30 1.2 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 30 1.2 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 30 1.2 At1g47620.1 68414.m05289 cytochrome P450, putative similar to cy... 30 1.2 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 30 1.2 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 29 1.6 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 29 1.6 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 29 2.1 At5g03480.1 68418.m00304 expressed protein ; expression support... 29 2.1 At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing ... 29 2.1 At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly id... 29 2.1 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 29 2.7 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 29 2.7 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 29 2.7 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 29 2.7 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 29 2.7 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 29 2.7 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 28 3.6 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 28 3.6 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 28 3.6 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 28 3.6 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 28 4.8 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 28 4.8 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 28 4.8 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 28 4.8 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 27 6.3 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 27 6.3 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 27 6.3 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 27 6.3 At3g61830.1 68416.m06941 transcriptional factor B3 family protei... 27 6.3 At3g14840.2 68416.m01875 leucine-rich repeat family protein / pr... 27 6.3 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 27 6.3 At3g56430.1 68416.m06276 expressed protein unknown protein At2g4... 27 8.3 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 27 8.3 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 54.4 bits (125), Expect = 5e-08 Identities = 22/41 (53%), Positives = 34/41 (82%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 +SRGFAFVR+ + +A +A++ +DGR++DGRE+ VQ A+YG Sbjct: 55 DSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Score = 50.4 bits (115), Expect = 8e-07 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 106 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 252 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR T Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRT 53 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 54.4 bits (125), Expect = 5e-08 Identities = 22/41 (53%), Positives = 34/41 (82%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 +SRGFAFVR+ + +A +A++ +DGR++DGRE+ VQ A+YG Sbjct: 55 DSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Score = 50.4 bits (115), Expect = 8e-07 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +1 Query: 106 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 252 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR T Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRT 53 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 44.8 bits (101), Expect = 4e-05 Identities = 22/37 (59%), Positives = 25/37 (67%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 252 SL V NL + EDLRR FE+ G V DIY+PRD YT Sbjct: 38 SLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYT 74 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 + RGF F++F + DA EA MDG +L GREL V A Sbjct: 76 DPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTVVFA 113 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 43.6 bits (98), Expect = 9e-05 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 252 SL V NL + EDLR+ FE+ G V DIY+PRD YT Sbjct: 37 SLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYT 73 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 + RGF FV+F + DA +A MDG +L GREL V A Sbjct: 75 DPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTVVFA 112 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 252 SL V N+ PE+LR FER G V D+YIPRD Y+ Sbjct: 48 SLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYS 84 Score = 36.3 bits (80), Expect = 0.014 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 + RGFAFV F + DA EA +M+ R GRE+ V +A Sbjct: 86 QPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVA 123 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 42.3 bits (95), Expect = 2e-04 Identities = 18/42 (42%), Positives = 30/42 (71%) Frame = +3 Query: 252 KESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 K S+G+AF++F + DA A++TMD RM +GR + + +A+ G Sbjct: 78 KRSKGYAFIQFTSQDDAFLAIETMDRRMYNGRMIYIDIAKPG 119 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 G+AFV F + RDAE+A+ DG DG LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 G+AFV F + RDAE+A+ DG DG LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 G+AFV F + RDAE+A+ DG DG LRV++A G Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGG 83 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 41.5 bits (93), Expect = 4e-04 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV F E DA A D MDG+ L GR LR+ A Sbjct: 81 SRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFA 117 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 41.5 bits (93), Expect = 4e-04 Identities = 20/40 (50%), Positives = 24/40 (60%) Frame = +3 Query: 249 HKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 +++ R F FV F ER DA A+D MDG L GR L V A Sbjct: 50 NQKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTVNYA 89 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/39 (46%), Positives = 28/39 (71%) Frame = +3 Query: 252 KESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 ++SRG AFV + R DA +A +MD ++L+GR+L V +A Sbjct: 95 RQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIA 133 Score = 31.1 bits (67), Expect = 0.51 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRK 258 +L V NL + T D+ +F G+V + + +DR+TR+ Sbjct: 58 TLYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQ 96 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 G+AFV F + RDA++A+ DG DG LRV++A G Sbjct: 46 GYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELAHGG 83 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 G+AFV F + RDA++A+ DG DG LRV++A G Sbjct: 46 GYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELAHGG 83 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = +1 Query: 133 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 252 G L + NL P DLR FER G + DIY+PR+ YT Sbjct: 45 GPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYT 84 Score = 35.5 bits (78), Expect = 0.024 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 E RGF FV++ DA EA+ M+ +++ GRE+ + A Sbjct: 86 EPRGFGFVKYRYAEDAAEAMKRMNHKVIGGREIAIVFA 123 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 39.5 bits (88), Expect = 0.001 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV F A A+ MDG+ L+GR++RV +A Sbjct: 75 SRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA 111 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 39.5 bits (88), Expect = 0.001 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV F A A+ MDG+ L+GR++RV +A Sbjct: 75 SRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA 111 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 SRGF FV F ++DA+ A++ M+G+ L R++R A G Sbjct: 184 SRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCNWATKG 223 Score = 37.1 bits (82), Expect = 0.008 Identities = 17/59 (28%), Positives = 34/59 (57%) Frame = +3 Query: 192 PRFRKVRRSW*YLHSQRSVHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 P +++ S + S + + K+ + FV +F+RR A A+ +++GR L G+ ++V A Sbjct: 73 PLLQEIFTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAILSLNGRHLFGQPIKVNWA 131 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/37 (40%), Positives = 27/37 (72%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 +GF F+ F DA +AL ++DG+++DGR + V++A+ Sbjct: 48 KGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEVAK 84 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRGF F+ F E++ +EA+ M+G LDGR + V A+ Sbjct: 47 SRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQ 84 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/38 (42%), Positives = 27/38 (71%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRG+ FV + + + E AL+++DG L+GR +RV +A+ Sbjct: 217 SRGYGFVCYSSKAEMETALESLDGFELEGRAIRVNLAQ 254 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 +SRGFAFV D +D +DG GR L+V A Sbjct: 124 QSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFA 161 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 SRGF FV F ++DA+ A+D + G+ L R++R A G Sbjct: 179 SRGFGFVSFRNQQDAQTAIDEITGKWLGSRQIRCNWATKG 218 Score = 36.3 bits (80), Expect = 0.014 Identities = 16/47 (34%), Positives = 29/47 (61%) Frame = +3 Query: 228 LHSQRSVHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 + S + + KE + FV +F+RR A A+ +++GR L G+ ++V A Sbjct: 80 VESCKLIRKEKSSYGFVHYFDRRSAGLAILSLNGRHLFGQPIKVNWA 126 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV F + A A+ MDG+ L+GR +RV A Sbjct: 75 SRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA 111 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV F + A A+ MDG+ L+GR +RV A Sbjct: 75 SRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA 111 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +1 Query: 151 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 249 V NLT+RTT +DLRR FE+ G+V D + + Y Sbjct: 16 VGNLTWRTTADDLRRYFEQFGQVVDANVVSETY 48 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 SRGF FV F ++DA+ A++ M+G+ + R++R A G Sbjct: 192 SRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWATKG 231 Score = 36.7 bits (81), Expect = 0.010 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +3 Query: 228 LHSQRSVHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 + S + + K+ + FV +F+RR A A+ T++GR + G+ ++V A Sbjct: 89 IESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWA 135 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 SRGF FV F ++DA+ A++ M+G+ + R++R A G Sbjct: 188 SRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWATKG 227 Score = 36.7 bits (81), Expect = 0.010 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +3 Query: 228 LHSQRSVHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 + S + + K+ + FV +F+RR A A+ T++GR + G+ ++V A Sbjct: 89 IESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWA 135 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 SRGF FV + +AE A+ MDG+ L+GR + V++ G Sbjct: 43 SRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVKLFGIG 82 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 37.9 bits (84), Expect = 0.004 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +3 Query: 267 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 + FV F RDAE+A+ DG LDG LRV++A G Sbjct: 47 YCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELAHGG 83 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 37.9 bits (84), Expect = 0.004 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 G+AFV F + RDA++A+ DG DG LRV++A G Sbjct: 46 GYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIAHGG 83 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 37.5 bits (83), Expect = 0.006 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+GF FV + ++ + A+ ++DG LDGR++RV A Sbjct: 244 SKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEA 280 Score = 31.5 bits (68), Expect = 0.39 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 SRGF FV + E A +G LDGR LRV Sbjct: 131 SRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRV 164 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 37.1 bits (82), Expect = 0.008 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRGF FV F + + +A++ M+G+ LDGR + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 151 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 246 V L + T EDL+R F + G+V D I DR Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDR 41 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 37.1 bits (82), Expect = 0.008 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRGF FV F + + +A++ M+G+ LDGR + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 151 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 246 V L + T EDL+R F + G+V D I DR Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDR 41 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 37.1 bits (82), Expect = 0.008 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRGF FV F + + +A++ M+G+ LDGR + V A+ Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQ 83 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 151 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 246 V L + T EDL+R F + G+V D I DR Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDR 41 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 37.1 bits (82), Expect = 0.008 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV + + EA+ +DG+ L+GR +RV +A Sbjct: 284 SRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVA 320 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 +SRGF FV +AE A++ + L+GR L V A Sbjct: 189 QSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKA 226 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 37.1 bits (82), Expect = 0.008 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 R +AFV F + RDA++A +DGR DG + V+ +R Sbjct: 3 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 39 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 37.1 bits (82), Expect = 0.008 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 R +AFV F + RDA++A +DGR DG + V+ +R Sbjct: 44 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSR 80 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 37.1 bits (82), Expect = 0.008 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRGF FV F + + ++A++ M+G+ LDGR + V A+ Sbjct: 48 SRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQ 85 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.1 bits (82), Expect = 0.008 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRGF FV F + + ++A++ M+G+ LDGR + V A+ Sbjct: 48 SRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQ 85 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 37.1 bits (82), Expect = 0.008 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = +3 Query: 273 FVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 FV FF+ RDA +AL M+G+++ G+ + +Q +R G Sbjct: 223 FVEFFDVRDAAKALRVMNGKVISGKPMVIQFSRPG 257 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 S+ F FV + + A+ A+D M+GR L G++L+VQ+ R Sbjct: 389 SKCFGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQLKR 426 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 36.7 bits (81), Expect = 0.010 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF F+ F + + AL TM+G ++GR LR+ +A Sbjct: 259 SRGFGFISFESAENVQSALATMNGVEVEGRALRLNLA 295 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 246 VHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 V SRGF FV +A+EA+ + + GR ++V Sbjct: 152 VTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 36.7 bits (81), Expect = 0.010 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV F R DA+ A++ ++G D LRV+ A Sbjct: 253 SRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWA 289 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 36.3 bits (80), Expect = 0.014 Identities = 14/42 (33%), Positives = 27/42 (64%) Frame = +3 Query: 252 KESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 ++S G+ +V F + DA+ A++ M+G+ DGR + V+ + G Sbjct: 115 RQSLGYGYVWFNSKEDAQSAVEAMNGKFFDGRFILVKFGQPG 156 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 36.3 bits (80), Expect = 0.014 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 R +AFV F + RDA++A +DGR DG + V+ +R Sbjct: 44 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 80 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 36.3 bits (80), Expect = 0.014 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 R +AFV F + RDA++A +DGR DG + V+ +R Sbjct: 3 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVEASR 39 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 35.9 bits (79), Expect = 0.018 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV F A A+ +DGR L GR ++V A Sbjct: 80 SRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYA 116 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 35.9 bits (79), Expect = 0.018 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+GF FV ++ ++A+++++G LDGR++RV A Sbjct: 289 SKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA 325 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 SRGF FV + E A +G +GR LRV Sbjct: 139 SRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRV 172 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 35.9 bits (79), Expect = 0.018 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+GF FV ++ ++A+++++G LDGR++RV A Sbjct: 297 SKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA 333 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 SRGF FV + E A +G +GR LRV Sbjct: 139 SRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRV 172 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 35.9 bits (79), Expect = 0.018 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = +3 Query: 246 VHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 V +GFAF+R+ +A +A+ M G+ LDGR + V+ A+ Sbjct: 113 VANRPKGFAFLRYETEEEAMKAIQGMHGKFLDGRVIFVEEAK 154 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +1 Query: 85 SILLKMSYGRPPPRIDG-MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRK 258 S L S PP G L V L++RTT + LR FE+ G + + + D+ + Sbjct: 58 SCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANR 116 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 35.5 bits (78), Expect = 0.024 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARY 374 E RGFAFV+F + D A++ +G + GR + V+ A + Sbjct: 59 EHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAH 98 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 +GFAFV+F ++DA A+ +G M R + V A Sbjct: 372 KGFAFVKFTCKKDAANAIKKFNGHMFGKRPIAVDWA 407 Score = 31.1 bits (67), Expect = 0.51 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 145 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 243 L + NL ++ P D++ VF G V D++IP++ Sbjct: 333 LIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKN 365 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 35.5 bits (78), Expect = 0.024 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGFAFV F +A A+ +DG+ L GR +RV A Sbjct: 74 SRGFAFVTFTSTEEASNAMQ-LDGQDLHGRRIRVNYA 109 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 35.1 bits (77), Expect = 0.031 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 362 SRGF FV F R DA+ A++ ++G D LRV+ Sbjct: 214 SRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVE 248 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 34.7 bits (76), Expect = 0.042 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV+ + A+ +DG+ L+GR ++V +A Sbjct: 247 SRGFGFVQMSNENEVNVAIAALDGQNLEGRAIKVNVA 283 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 +SRGF FV +AE+A++ + ++GR L V A Sbjct: 152 QSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRA 189 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 34.7 bits (76), Expect = 0.042 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +3 Query: 273 FVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 FV F++ RDA A D M+G+ + G+++ ++ +R G Sbjct: 253 FVEFYDVRDAARAFDRMNGKEIGGKQVVIEFSRPG 287 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 34.7 bits (76), Expect = 0.042 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 362 S+GF FV F + A+D M+G+ LDGR + Q Sbjct: 84 SKGFRFVTFKDEDSMRTAIDRMNGQELDGRNITAQ 118 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 34.7 bits (76), Expect = 0.042 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 S+ F F+ + + A+ A++TM+G L G++L+VQ+ R Sbjct: 379 SKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 416 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 34.7 bits (76), Expect = 0.042 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 S+ F F+ + + A+ A++TM+G L G++L+VQ+ R Sbjct: 370 SKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQLKR 407 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 34.3 bits (75), Expect = 0.055 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 +GF F+ F DA++AL ++G++++GR + V+ A+ Sbjct: 107 KGFGFITFESEDDAQKALKALNGKIVNGRLIFVETAK 143 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 34.3 bits (75), Expect = 0.055 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 S+GF FVR+ D+ + + MDG+ LDG + + AR Sbjct: 96 SKGFGFVRYATLEDSAKGIAGMDGKFLDGWVIFAEYAR 133 Score = 33.9 bits (74), Expect = 0.073 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 121 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 246 P+ + +L V L+ RTT E LR F + GEV D + DR Sbjct: 50 PQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDR 91 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 34.3 bits (75), Expect = 0.055 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 +G+AF+ + RD + A DG+ +DGR + V + R Sbjct: 179 KGYAFIEYMHTRDMKAAYKQADGQKIDGRRVLVDVER 215 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 34.3 bits (75), Expect = 0.055 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 RGF F+ F +RR A++A+ M GR L + + V A Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKA 88 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 34.3 bits (75), Expect = 0.055 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 RGF F+ F +RR A++A+ M GR L + + V A Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKA 88 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 33.9 bits (74), Expect = 0.073 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +3 Query: 246 VHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 V S+GF FV F +A++AL +G+ L+GR + V A+ Sbjct: 70 VSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAK 111 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.9 bits (74), Expect = 0.073 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 106 YGRPPPRIDGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 243 YGR P G+ + + V L + +DLR F R G + D YIP+D Sbjct: 228 YGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKD 274 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 184 DLRRVFERCGEVGDIYIPRD 243 D R FER GE+ D+Y+P+D Sbjct: 106 DFRSHFERYGEITDLYMPKD 125 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 33.9 bits (74), Expect = 0.073 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 +S GF FV F D E A+ ++ +L+G+++RV A Sbjct: 216 KSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 365 SR F F DA ++ ++G ++GRE++V + Sbjct: 116 SRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVNI 151 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 33.5 bits (73), Expect = 0.096 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRG+ FV F A A+ M+G+ L+G + V +A+ Sbjct: 71 SRGYGFVNFISEDSANSAISAMNGQELNGFNISVNVAK 108 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 33.5 bits (73), Expect = 0.096 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 362 ESRGFAF+ F A A+ MDGR++ + L VQ Sbjct: 55 ESRGFAFIEFESADSAGRAMLHMDGRLIGQKILCVQ 90 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 33.5 bits (73), Expect = 0.096 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 130 DGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT 252 DG ++ L V ++ T D+R+VFE+ G V +I +P+D+ T Sbjct: 106 DGSIAKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMT 147 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 33.5 bits (73), Expect = 0.096 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 252 KESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 +ESRGF F+ DA + ++D +L GR + V+ AR Sbjct: 113 RESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKAR 152 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 33.1 bits (72), Expect = 0.13 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 249 S+ V N+ Y TPE++++ F+ CG V + I D++ Sbjct: 104 SIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF 139 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 33.1 bits (72), Expect = 0.13 Identities = 15/43 (34%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = +3 Query: 240 RSVHK--ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 362 R++H ++RGF V +++ R A++A + GR+L GR+L ++ Sbjct: 238 RALHTAGKNRGFIMVSYYDIRAAQKAARALHGRLLRGRKLDIR 280 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/41 (31%), Positives = 28/41 (68%) Frame = +3 Query: 237 QRSVHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 +R++H+ S+ ++ FF+ R A+ AL ++G + GR+L++ Sbjct: 325 RRTMHENSQ--VYIEFFDVRKAKVALQGLNGLEVAGRQLKL 363 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 97 KMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERC 210 K S G P +DG + + NL + TT D+R++F C Sbjct: 248 KTSSGFAPEMVDGYNRVYIGNLAWDTTERDIRKLFSDC 285 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLD--GRELRVQMAR 371 SRGFAFV F+ DA +AL+ + L+ G+ LRV A+ Sbjct: 498 SRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAK 537 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+G+ FVRF + + AL M+G R++RV +A Sbjct: 243 SKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIA 279 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 33.1 bits (72), Expect = 0.13 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +1 Query: 121 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 243 P G L V NL + +DLR+VFE G V + +PRD Sbjct: 279 PYSGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRD 319 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 33.1 bits (72), Expect = 0.13 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 +S+GF FV F DA A+D ++G+ D +E V A+ Sbjct: 262 KSKGFGFVNFENSDDAARAVDALNGKTFDDKEWFVGKAQ 300 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRG FV F +A A+ M+G+M+ + L V +A+ Sbjct: 366 SRGSGFVAFSTPEEATRAITEMNGKMIVTKPLYVALAQ 403 Score = 27.9 bits (59), Expect = 4.8 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 +S+G+ FV++ A+ A+D ++G +L+ +++ V Sbjct: 171 QSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYV 205 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 32.7 bits (71), Expect = 0.17 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+G+ FVRF + + A+ M+G R++RV +A Sbjct: 254 SKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIA 290 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 32.3 bits (70), Expect = 0.22 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF F+ F +RR +E++ M GR R + V A Sbjct: 47 SRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRA 83 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 32.3 bits (70), Expect = 0.22 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 R +AFV F DA A++++ G L G LR++ A+ Sbjct: 58 RSYAFVNFNHDEDAFAAIESLQGFPLSGNPLRIEFAK 94 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 32.3 bits (70), Expect = 0.22 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 ++RGFAFV +A+ A+D D + GR + V AR Sbjct: 133 KNRGFAFVTMASGEEAQAAIDKFDTFQVSGRIISVSFAR 171 >At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing protein similar to Tat-SF1 - Homo sapiens, GI:1667611; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 519 Score = 31.9 bits (69), Expect = 0.29 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 365 +G VRF +RRDA++ ++ M+GR R++ + Sbjct: 454 QGVVLVRFKDRRDAQKCIEAMNGRWYAKRQIHASL 488 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 31.9 bits (69), Expect = 0.29 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 +S+GF FV F +A +A+ T G+M G+ L V +A+ Sbjct: 342 KSKGFGFVCFSTPEEAIDAVKTFHGQMFHGKPLYVAIAQ 380 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 RG+AFV F DA A +T++G + L V A+ Sbjct: 241 RGYAFVNFDNPEDARRAAETVNGTKFGSKCLYVGRAQ 277 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 31.9 bits (69), Expect = 0.29 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGR 347 +GFA+V F + +AE+AL ++ +++DGR Sbjct: 62 KGFAYVTFSSKEEAEKALLELNAQLVDGR 90 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 31.9 bits (69), Expect = 0.29 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRGF FV + +A AL M+G+M+ + L + +A+ Sbjct: 371 SRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALAQ 408 Score = 29.9 bits (64), Expect = 1.2 Identities = 10/34 (29%), Positives = 24/34 (70%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 S+G+ FV+F + A+ A+D ++G +++ +++ V Sbjct: 175 SKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFV 208 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 31.5 bits (68), Expect = 0.39 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 249 S+ V N+ Y TPE++++ F+ CG V + I D++ Sbjct: 93 SVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTDKF 128 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 + +GFA+V F E +EAL + L GR+L+V R Sbjct: 130 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKVLQKR 167 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 31.5 bits (68), Expect = 0.39 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 249 S+ V N+ Y TPE+++ F+ CG V + I D++ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF 125 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 + +GFA+V F E +EAL + L GR+L+V R Sbjct: 127 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKVSPKR 164 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 31.5 bits (68), Expect = 0.39 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 249 S+ V N+ Y TPE+++ F+ CG V + I D++ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKF 125 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 + +GFA+V F E +EAL + L GR+L+V R Sbjct: 127 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKVSPKR 164 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 +S+GF FV F DA A+++++G D +E V A+ Sbjct: 67 KSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQ 105 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 240 RSVHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 R + S+G FV F +A EA+ + G+M++ + L V +A+ Sbjct: 165 RDPNGTSKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIAQ 208 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 31.5 bits (68), Expect = 0.39 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 S+GF FV + DAE+A M+ + LDG + V AR Sbjct: 74 SKGFGFVTYATIEDAEKAKAEMNAKFLDGWVIFVDPAR 111 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 S+G FV F +A L+ M+G+M+ G+ L V +A+ Sbjct: 367 SKGSGFVAFSAASEASRVLNEMNGKMVGGKPLYVALAQ 404 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELR 356 RG +V F R DAE+A MDG +DG+ ++ Sbjct: 139 RGHGYVEFKARADAEKAQLYMDGAQIDGKVVK 170 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELR 356 RG +V F R DAE+A MDG +DG+ ++ Sbjct: 139 RGHGYVEFKARADAEKAQLYMDGAQIDGKVVK 170 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 31.1 bits (67), Expect = 0.51 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+G+ FV++ + + A A+ M+G +GR L V++A Sbjct: 520 SKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRIA 556 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 31.1 bits (67), Expect = 0.51 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+G+ FV++ + + A A+ M+G +GR L V++A Sbjct: 520 SKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRIA 556 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 31.1 bits (67), Expect = 0.51 Identities = 12/35 (34%), Positives = 25/35 (71%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 +S+GFAF+ + ++R A+D ++G ++ GR ++V Sbjct: 75 KSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKV 109 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 151 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRK 258 V + + T DL VF + GE+ D+ + RD+ T K Sbjct: 40 VGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGK 75 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 31.1 bits (67), Expect = 0.51 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +3 Query: 246 VHKESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 + K S+G+AF+ + A AL M+G++++G + V +A+ Sbjct: 318 ISKRSKGYAFLEYTTEEAAGTALKEMNGKIINGWMIVVDVAK 359 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 30.7 bits (66), Expect = 0.68 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 145 LKVDNLTYRTTPEDLRRVFERCGEVGDI 228 L N+ + +TPED+R +FE+ G V DI Sbjct: 96 LIAQNVPWTSTPEDIRSLFEKYGSVIDI 123 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +3 Query: 237 QRSVHKE--SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 + S+HK+ +RG F+ +A AL +++ +GR L+V A+ Sbjct: 124 EMSMHKKERNRGLVFIEMASPEEAATALKSLESCEYEGRRLKVDYAK 170 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 30.7 bits (66), Expect = 0.68 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +1 Query: 151 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRKVEDSPS*GFSSVVTLKK 309 V +L + EDL++VF GEV ++ I ++ T+K + S F++V K+ Sbjct: 218 VGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKR 270 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +3 Query: 252 KESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 K+S+G AF+RF A+ A+ + M++G++ V Sbjct: 252 KKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGV 287 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 30.3 bits (65), Expect = 0.89 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 103 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 237 +Y PP ++ V NL T E+L++ F + GEV + IP Sbjct: 225 AYVAPPESDVTCTTISVANLDQNVTEEELKKAFSQLGEVIYVKIP 269 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+G+ FV+F E + A+ M+G R +R+ A Sbjct: 157 SKGYGFVKFAEESERNRAMAEMNGLYCSTRPMRISAA 193 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 30.3 bits (65), Expect = 0.89 Identities = 12/36 (33%), Positives = 26/36 (72%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 +G+ + F +A++AL+ M+G++L GR++R+ +A Sbjct: 424 KGYGHIEFASPEEAQKALE-MNGKLLLGRDVRLDLA 458 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 181 EDLRRVFERCGEVGDIYIPRDRYT 252 ++LR F +CGEV +++P DR T Sbjct: 497 KELRSHFSKCGEVTRVHVPTDRET 520 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 30.3 bits (65), Expect = 0.89 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 103 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRK 258 SY R P + V L + T +++RR FE+ GE+ + I D+ T K Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 30.3 bits (65), Expect = 0.89 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 103 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRK 258 SY R P + V L + T +++RR FE+ GE+ + I D+ T K Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 30.3 bits (65), Expect = 0.89 Identities = 11/34 (32%), Positives = 24/34 (70%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 S+G+ FV+F + A+ A+D ++G +L+ +++ V Sbjct: 171 SKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFV 204 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRGF FV + +A A+ M+G+M+ + L V +A+ Sbjct: 367 SRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALAQ 404 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 30.3 bits (65), Expect = 0.89 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 +SR F FV F + A A++ M+G ++D +EL V A+ Sbjct: 157 KSRRFGFVNFEKAEAAVTAIEKMNGVVVDEKELHVGRAQ 195 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 S+G FV F +A +A+ M+G+M+ + + V +A+ Sbjct: 262 SKGVGFVEFSTSEEASKAMLKMNGKMVGNKPIYVSLAQ 299 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 30.3 bits (65), Expect = 0.89 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 SRGF FV + A A+ M + LDGR + V A G Sbjct: 76 SRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPADSG 115 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 30.3 bits (65), Expect = 0.89 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 252 KESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 362 +ESRGF F+ DA + ++D +L GR + V+ Sbjct: 83 RESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVE 119 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQMAR 371 GFAFV + RDAE+A+ +D GR GR LRV+ + Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGR--TGRRLRVEWTK 73 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQMAR 371 GFAFV + RDAE+A+ +D GR GR LRV+ + Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGR--TGRRLRVEWTK 73 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGR 347 SRGFAFV +DAE + ++ +L+GR Sbjct: 112 SRGFAFVTMSSLKDAERCIKYLNQSVLEGR 141 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGR 347 SRGFAFV +DAE + ++ +L+GR Sbjct: 111 SRGFAFVTMSSLKDAERCIKYLNQSVLEGR 140 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQMAR 371 GFAFV + RDAE+A+ +D GR GR LRV+ + Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEFGR--KGRRLRVEWTK 73 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF FV F +A++A++++ G L ++L V A Sbjct: 241 SRGFGFVNFCNPENAKKAMESLCGLQLGSKKLFVGKA 277 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 +S+GF FV+F + A A + G M+ G++L V Sbjct: 149 QSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFV 183 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/37 (32%), Positives = 25/37 (67%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 S+GF FV F ++++A ++G ++DG+ + V++A Sbjct: 343 SKGFGFVCFSNCEESKQAKRYLNGFLVDGKPIVVRVA 379 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 SRGF F+ + ++ A+++M G+ L R++ V A Sbjct: 153 SRGFGFISYDSFEASDAAIESMTGQYLSNRQITVSYA 189 >At1g47620.1 68414.m05289 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 520 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +2 Query: 137 WSR*K*IILPTERR-LKTYAAFSKGAEKLVISTFPEIGTQG 256 W K I + TE++ LK +A F + EK++ + E+G+QG Sbjct: 235 WKLQKWIGIGTEKKMLKAHATFDRVCEKIIAAKREELGSQG 275 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 362 ESRG +V A+ A+ ++DG + GRE+RV+ Sbjct: 147 ESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVR 182 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 145 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 249 L V +L + T +++ +F + G V D+Y+ RD Y Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEY 247 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +3 Query: 228 LHSQRSVHKESRGFAFVRFFERRDAEEALDTMDG 329 ++ R +++SRG FV++ + A A+D ++G Sbjct: 240 VYLMRDEYRQSRGCGFVKYSSKETAMAAIDGLNG 273 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 145 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY 249 L V +L + T +++ +F + G V D+Y+ RD Y Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEY 247 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +3 Query: 228 LHSQRSVHKESRGFAFVRFFERRDAEEALDTMDG 329 ++ R +++SRG FV++ + A A+D ++G Sbjct: 240 VYLMRDEYRQSRGCGFVKYSSKETAMAAIDGLNG 273 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 S+G+ FVRF + + A+ M+G+ R +R+ Sbjct: 195 SKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRI 228 >At5g03480.1 68418.m00304 expressed protein ; expression supported by MPSS Length = 321 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 187 LRRVFERCGEVGDIYIPRDRYTRKVEDSPS 276 L + F CGE+ IY+PRD + +K+ S S Sbjct: 44 LTKHFASCGEITQIYVPRD-FKKKILKSVS 72 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 187 LRRVFERCGEVGDIYIPRDRYTRKV 261 L + F+ CGE+ +Y+P D Y R V Sbjct: 133 LEKHFDSCGEIRHVYVPTD-YERGV 156 >At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 198 Score = 29.1 bits (62), Expect = 2.1 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +1 Query: 184 DLRRVFERCGEVGDIYIPRDR 246 +L+++F CGE+ D++IP R Sbjct: 42 ELKKLFSPCGEITDVHIPETR 62 >At2g37340.2 68415.m04579 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 260 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 S F F + RDA++A +DGR DG + V+ +R Sbjct: 13 SSHFRNQEFGDPRDADDARHYLDGRDFDGSRITVEFSR 50 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALD-TMDGRMLD 341 R FAFV+F + DA +ALD T + ++LD Sbjct: 103 RNFAFVQFATQEDATKALDSTHNSKLLD 130 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +3 Query: 243 SVHKESRGFAFVRFFERRDAEEALDTMDGRML--DGRELRVQMAR 371 S+H ++ G+AFV F + RDAE+A+ D R+L V+ A+ Sbjct: 4 SLHIDA-GYAFVYFEDERDAEDAIRRTDNTTFGYGRRKLSVEWAK 47 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +3 Query: 261 RGFAFVRFFERRDAEEALD-TMDGRMLD 341 R FAFV+F + DA +ALD T + ++LD Sbjct: 129 RNFAFVQFATQEDATKALDSTHNSKLLD 156 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMDGRML--DGRELRVQMAR 371 G+AFV F + RDAE+A+ D R+L V+ A+ Sbjct: 36 GYAFVYFEDERDAEDAIRRTDNTTFGYGRRKLSVEWAK 73 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 240 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 273 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 238 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 359 S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 238 SKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 103 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRK 258 SY R P + V L + T +++RR F++ GE+ + I D+ T K Sbjct: 5 SYYRSPFGDTTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGK 56 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 151 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 246 V L + T EDL+R F + G+V D I DR Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDR 41 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +3 Query: 264 GFAFVRFFERRDAEEALDTMDGRML--DGRELRVQMAR 371 G+AFV F + RDAE+A+ +D + R L V+ A+ Sbjct: 36 GYAFVYFEDERDAEDAIRKLDNFPFGYEKRRLSVEWAK 73 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 +++GF FV F R+ A+EAL R+L+ R Q+A G Sbjct: 143 KAKGFGFVMFKTRKGAKEALKEPKKRILN-RTATCQLASMG 182 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMARYG 377 +++GF FV F R+ A+EAL R+L+ R Q+A G Sbjct: 143 KAKGFGFVMFKTRKGAKEALKEPKKRILN-RTATCQLASMG 182 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 246 VHKESRGFAFVRFFERRDAEEALDTMDGR 332 V + G+AF+ F + RDA +A+ +DG+ Sbjct: 33 VARRPPGYAFLDFEDPRDARDAIRALDGK 61 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 356 S+G+ FVRF + + A+ M+G+ R +R Sbjct: 214 SKGYGFVRFADESEQIRAMTEMNGQYCSSRPMR 246 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 27.9 bits (59), Expect = 4.8 Identities = 10/38 (26%), Positives = 24/38 (63%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 368 +S+G+AFV F + A++A++ + + G+ +R ++ Sbjct: 155 DSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLS 192 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 142 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 237 +L V N+ T+ E L+ +F+R GEV I P Sbjct: 293 ALYVKNIPENTSTEQLKELFQRHGEVTKIVTP 324 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 255 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 356 + +G+AFV F + A EA+DT++ G+ ++ Sbjct: 131 DGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIK 164 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +1 Query: 109 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTR 255 GR I+ L + NL Y ED++ +F GE+ + DR R Sbjct: 76 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGR 124 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +1 Query: 109 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTR 255 GR I+ L + NL Y ED++ +F GE+ + DR R Sbjct: 12 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGR 60 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +1 Query: 109 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTR 255 GR I+ L + NL Y ED++ +F GE+ + DR R Sbjct: 78 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRSGR 126 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = +3 Query: 252 KESRGFAFVRFFERRDAEEALDTMDGRM 335 ++S G+ +V F + DA+ A++ M+G++ Sbjct: 96 RQSLGYGYVWFNSKEDAQSAVEAMNGKV 123 >At3g61830.1 68416.m06941 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profile: PF02309 AUX/IAA family Length = 602 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = -3 Query: 362 LNAKFPAVQHSSVHRVQGFFSVTTLEKPHEGESSTFLVYRSLGM*ISPTSP 210 +NA Q S+ R+ G +S KP T YR G ++ SP Sbjct: 402 INASLKLFQDPSLERISGGYSSNNSFKPETPPPPTNCSYRLFGFDLTSNSP 452 >At3g14840.2 68416.m01875 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; contains 2 predicted transmembrane domains Length = 988 Score = 27.5 bits (58), Expect = 6.3 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 8/92 (8%) Frame = +2 Query: 26 YTKVNLTTL---YYSICLI*AEY---LYYSK*VTEDLRHESMAWSR*K*IILPTERRLKT 187 YT+ L+ + Y ++CL Y L++++ + + S R I + +R +K Sbjct: 445 YTQARLSAISLTYQALCLGKGNYTVNLHFAEIMFNEKNMYSNLGRRYFDIYVQGKREVKD 504 Query: 188 YAAF--SKGAEKLVISTFPEIGTQGK*RIRLR 277 + +KG K V+ FP + T GK IRL+ Sbjct: 505 FNIVDEAKGVGKAVVKKFPVMVTNGKLEIRLQ 536 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 246 VHKESRGFAFVRFFERRDAEEALDTMDGR 332 V + G+AF+ F + RDA +A+ +DG+ Sbjct: 33 VARRPPGYAFLDFEDSRDARDAIREVDGK 61 >At3g56430.1 68416.m06276 expressed protein unknown protein At2g40800 - Arabidopsis thaliana, EMBL:AC007660 Length = 434 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 374 ISRHLNAKFPAVQHSSVHRVQGFFSVTTLEKPHEGESSTFLVYR-SLGM 231 ++ + + F S +V G F+ ++KP + SSTF YR +LG+ Sbjct: 125 VNMNFVSAFRLFSSSGFRKVDGNFARKVVDKPIKAVSSTFARYRMALGL 173 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 258 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMAR 371 SRG+ FV + ++ A + ++DGRE+ V R Sbjct: 104 SRGYGFVEYETEKEMLRAYEDAHHSLIDGREIIVDYNR 141 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,227,755 Number of Sequences: 28952 Number of extensions: 198467 Number of successful extensions: 738 Number of sequences better than 10.0: 145 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -