BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0515 (714 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 50 4e-05 UniRef50_A3FQ29 Cluster: CGMP phosphodiesterase A4; n=2; Cryptos... 37 0.57 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 50.4 bits (115), Expect = 4e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 353 LLLRWVDELTAHLVLSGYWSP 291 LLLRWVDELTAHLVLSGYWSP Sbjct: 155 LLLRWVDELTAHLVLSGYWSP 175 >UniRef50_A3FQ29 Cluster: CGMP phosphodiesterase A4; n=2; Cryptosporidium|Rep: CGMP phosphodiesterase A4 - Cryptosporidium parvum Iowa II Length = 997 Score = 36.7 bits (81), Expect = 0.57 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = -2 Query: 527 LIGLKYRLNYYKGFRFQNIKRNFSTAYIKILISPSELNAQISQFELLFR 381 LI L+ + N GF N+ R +TAY + +PS+L IS+F + FR Sbjct: 666 LIALEEK-NQESGFDSSNLPRGITTAYSSSITAPSKLIGNISKFNIFFR 713 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,475,365 Number of Sequences: 1657284 Number of extensions: 12662929 Number of successful extensions: 26888 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26883 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57438021881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -