BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0515 (714 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0121 - 12507258-12507968 30 2.1 01_06_1749 - 39636951-39638102 29 4.8 01_06_0355 + 28657833-28660665,28660762-28661126 28 8.5 >09_03_0121 - 12507258-12507968 Length = 236 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -1 Query: 270 APPTLNTSSKVSSIVTTAAPPFKPKRITASRQK*YYAIFL 151 A PT + ++ VS+ TT PP P+ AS Q YYA+ L Sbjct: 14 AVPTPSAAAAVST--TTTTPPGTPRATAASPQAGYYAVEL 51 >01_06_1749 - 39636951-39638102 Length = 383 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 237 SSIVTTAAPPFKPKRITA 184 SS+ + AAPPF P RIT+ Sbjct: 164 SSVASAAAPPFDPSRITS 181 >01_06_0355 + 28657833-28660665,28660762-28661126 Length = 1065 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 337 WTSSQPT--WC*VVTGAHRHPQRKCATHL 257 WT++ P W V G HRHP R A L Sbjct: 56 WTAAAPYCGWLGVTCGGHRHPLRVTALEL 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,695,047 Number of Sequences: 37544 Number of extensions: 318094 Number of successful extensions: 581 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -