BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0515 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38704| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) 29 4.9 SB_15719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_11020| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_54898| Best HMM Match : Peptidase_M19 (HMM E-Value=8.4e-12) 28 8.6 >SB_38704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -2 Query: 530 ILIGLKYRLNYYKGFRFQNIKRNFSTAYIKILISPSEL 417 I I LK RL+Y ++FQN++ N K L+ SEL Sbjct: 42 IPIKLKRRLSYKHHYQFQNVRPNKVLEAAKYLVRTSEL 79 >SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) Length = 872 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 251 QVLRSPV*LQRLPHPSNRNALLLHGRNSIMLSFYN 147 Q LR +QR P P+ RN++ LHG + + +N Sbjct: 22 QALRQQNQVQRRPEPTPRNSIFLHGLRAQTATNFN 56 >SB_15719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 601 YFYNNCEKSTVLSIR 557 Y+YNNC TVL++R Sbjct: 19 YYYNNCSNETVLNVR 33 >SB_11020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.9 bits (59), Expect = 8.6 Identities = 21/55 (38%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = -1 Query: 330 AHSPPGVKWLLEPI--DIHNVNAPPTLNTSSKVSSIVTTAAPPFKPKRITASRQK 172 A +P GVKWLL + D V A S S IV T P PK + R K Sbjct: 74 ATAPAGVKWLLIYMMKDRELVKAWVRRAEESGFSGIVVTVDSPEGPKNYSIERNK 128 >SB_54898| Best HMM Match : Peptidase_M19 (HMM E-Value=8.4e-12) Length = 226 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/25 (36%), Positives = 20/25 (80%) Frame = +2 Query: 200 GLKGGAAVVTILETLELVFKVGGAF 274 G++GG A+ + L+TL +++++GG + Sbjct: 96 GIEGGHAIDSSLDTLRMMYEMGGRY 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,125,274 Number of Sequences: 59808 Number of extensions: 384073 Number of successful extensions: 657 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -