BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0514 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52444| Best HMM Match : Copine (HMM E-Value=3.9e-16) 30 1.6 SB_39782| Best HMM Match : Chromo_shadow (HMM E-Value=1.4e-23) 29 4.9 >SB_52444| Best HMM Match : Copine (HMM E-Value=3.9e-16) Length = 356 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 639 FVIPFNNXFRLCFSRTG-ITRLRSCVRAIDLYGPFNI 532 F + FN+ C G I + CVR + LYGP NI Sbjct: 173 FALNFNHTNPFCAGLQGLIEAYQQCVRQVTLYGPTNI 209 >SB_39782| Best HMM Match : Chromo_shadow (HMM E-Value=1.4e-23) Length = 226 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 94 FSSKKMQKGKRK--SDEDGVSSPKKKKLNSSHE 186 + KK KRK + E G S PKK+K+N+ E Sbjct: 74 YEKKKKASSKRKDSTSEKGESKPKKRKVNAYEE 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,087,608 Number of Sequences: 59808 Number of extensions: 227153 Number of successful extensions: 589 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -