BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0514 (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60030.1 68418.m07527 expressed protein 29 4.0 At2g28520.1 68415.m03465 vacuolar proton ATPase, putative simila... 28 5.3 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +1 Query: 103 KKMQKGKRKSDEDGVSSPKK-KKLNSSHEQ 189 KK +K KRKSDE+ VS +K KK S E+ Sbjct: 244 KKEKKKKRKSDEEIVSEERKSKKKRKSDEE 273 >At2g28520.1 68415.m03465 vacuolar proton ATPase, putative similar to Swiss-Prot:Q93050 vacuolar proton translocating ATPase 116 kDa subunit A isoform 1 (Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, Vacuolar proton pump subunit 1, Vacuolar adenosine triphosphatase subunit Ac116) [Homo sapiens] Length = 817 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -2 Query: 533 YCAILYRSYFEVRFHNF--SLYXC 468 YC ++Y +F V FH F S Y C Sbjct: 480 YCGLIYNEFFSVPFHIFGGSAYKC 503 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,833,691 Number of Sequences: 28952 Number of extensions: 162112 Number of successful extensions: 473 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -