BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0513 (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 100 1e-21 SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 97 1e-20 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 9e-18 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 6e-16 SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 58 5e-09 SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 58 5e-09 SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) 42 6e-04 SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) 38 0.010 SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) 36 0.038 SB_21382| Best HMM Match : Ail_Lom (HMM E-Value=2.5) 33 0.15 SB_15059| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 29 4.4 SB_871| Best HMM Match : 7tm_1 (HMM E-Value=0.0017) 29 4.4 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) 28 5.8 SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) 28 5.8 SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) 28 7.7 SB_38230| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 28 7.7 SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) 28 7.7 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 28 7.7 >SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 725 Score = 100 bits (239), Expect = 1e-21 Identities = 53/127 (41%), Positives = 74/127 (58%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 F+ LFD I+E YH +K DKH + T NLDP G F+ STR+R R+L+GY Sbjct: 445 FSPLFDKIVEHYHAPYKLADKHTSDMNPEKVTAPNLDPDGVFIRSTRIRVARNLKGYALT 504 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLIRRPLPCSRRATAFLQ 617 P LT + E+E KV+ L SL G+L G +Y LTGM + T+Q+L+ ++ FL+ Sbjct: 505 PGLTRKERNEIEKKVTEVLCSLTGDLAGKYYPLTGMDEATRQKLVDDHF-LFKKGDRFLE 563 Query: 618 AANALQL 638 AA +L Sbjct: 564 AAGVNKL 570 Score = 74.9 bits (176), Expect = 5e-14 Identities = 38/73 (52%), Positives = 51/73 (69%), Gaps = 1/73 (1%) Frame = +1 Query: 19 KAATMVDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQS 195 K+ ++ A +EK + F + L + KSLLKKYLT E+F+SLK+KKT+ G +L DCI S Sbjct: 337 KSLLEIERAAIEKQRSVFPEALNKEECKSLLKKYLTAEMFNSLKDKKTAKGISLYDCINS 396 Query: 196 GVENLDSGVGIYA 234 GV NLDS G+YA Sbjct: 397 GVVNLDSSCGVYA 409 Score = 53.6 bits (123), Expect(2) = 5e-10 Identities = 28/60 (46%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEG--YP 431 FA LFD +IEDYH+ +K D H D +LDP F+ STR+R GR L G YP Sbjct: 98 FAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRDLAGKYYP 157 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +1 Query: 31 MVDAATLEKLEAGFS-----KLQGSDSKSLLKKYLTREVFDSLKNKKTSFG 168 M DAA EK + + K + K LLKKYLT +VFD LK KKT G Sbjct: 8 MADAAEAEKYRSKNAYPVPLKSAKCNPKCLLKKYLTNQVFDQLKTKKTKRG 58 Score = 27.9 bits (59), Expect(2) = 5e-10 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 510 ELKGTFYHLTGMSKETQQQLIRRPLPCSRRATAFLQAA 623 +L G +Y LTGM + T++QL+ ++ FL AA Sbjct: 150 DLAGKYYPLTGMDEVTREQLVNDHF-LFKKGDRFLDAA 186 >SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 969 Score = 97.1 bits (231), Expect = 1e-20 Identities = 51/122 (41%), Positives = 71/122 (58%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 F ELFD IIEDYH +K + H + NLD G F+ STR+R R+L+GY Sbjct: 690 FGELFDKIIEDYHAPYKLEENHKSDMDPEKVDAPNLDAEGAFIRSTRIRVARNLKGYALT 749 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLIRRPLPCSRRATAFLQ 617 P LT + ++E KV G L+SL G+L G +Y L+GM + T+QQL+ ++ FL+ Sbjct: 750 PGLTRKERVDVESKVVGVLNSLTGDLAGKYYPLSGMDEATRQQLVDDHF-LFKKGDRFLE 808 Query: 618 AA 623 AA Sbjct: 809 AA 810 Score = 95.5 bits (227), Expect = 3e-20 Identities = 46/105 (43%), Positives = 64/105 (60%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 FA LFD IIEDYH +K KH + +LDP G F+ STR+R R+L+GY Sbjct: 258 FAPLFDKIIEDYHAPYKLEQKHTSDMNPEKVEAPDLDPEGSFIRSTRIRVARNLKGYALT 317 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 P L++ E+E+KV SL G+L G ++ L GM++ET+QQL+ Sbjct: 318 PALSKKARLEIEEKVKNVFESLTGDLAGKYHPLDGMTEETRQQLV 362 Score = 83.4 bits (197), Expect = 1e-16 Identities = 42/74 (56%), Positives = 52/74 (70%), Gaps = 1/74 (1%) Frame = +1 Query: 34 VDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 210 ++ A +E F + L+ + KSL+KKYLT E+F+ LK+KKT G TL DCI SGVENL Sbjct: 182 IEKAAVEAKRNVFPEVLKKPEVKSLMKKYLTEEMFNELKDKKTELGVTLSDCINSGVENL 241 Query: 211 DSGVGIYAPDAESY 252 DSG GIYA D ESY Sbjct: 242 DSGTGIYAGDEESY 255 Score = 82.2 bits (194), Expect = 3e-16 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%) Frame = +1 Query: 34 VDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 210 ++ A +E+ F + L+ + KSLLKKYLT +VF+SLK KKTS G+ L DCI SGV NL Sbjct: 614 IERAAIEEAHLKFPEDLKKPEVKSLLKKYLTEDVFNSLKEKKTSRGAGLYDCINSGVVNL 673 Query: 211 DSGVGIYAPDAESY 252 DSG G+YA D E Y Sbjct: 674 DSGTGVYAADEECY 687 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 92.7 bits (220), Expect = 2e-19 Identities = 48/105 (45%), Positives = 65/105 (61%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 FAELFDP+IE+ H+GFKK+DKH G D ++V+S+RVR GRS+ G+ Sbjct: 118 FAELFDPVIEERHSGFKKSDKHKTDLDSSKIRGGKFDE--KYVLSSRVRTGRSIRGFSLP 175 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 P T ++ +E+E V+ L L G+L G +Y L GMS QQQLI Sbjct: 176 PHCTRAERREVERIVNDALDGLGGDLNGKYYPLNGMSDAQQQQLI 220 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = +1 Query: 100 SLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESY 252 +L+ K+LT ++ L++K T G TL IQ+GV+N S VG+ A D ESY Sbjct: 61 NLMAKHLTPRLYVKLRDKSTPNGYTLDQAIQTGVDNPGHPFISTVGLVAGDEESY 115 >SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 87.4 bits (207), Expect = 9e-18 Identities = 46/105 (43%), Positives = 63/105 (60%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 FA+LFDP+IE+ HNG+KKTDKH G+ D +V+STR R GRS+ G+ Sbjct: 459 FADLFDPVIEERHNGYKKTDKHVTDLNHRKLKGGSFDE--RYVLSTRCRTGRSIRGFSLP 516 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 P T ++ + +E V L L G+L GT+Y L M+ E Q+QLI Sbjct: 517 PHCTRAERRSVEKVVVDALDQLGGDLSGTYYPLGKMTNEEQEQLI 561 Score = 34.3 bits (75), Expect = 0.089 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 4/53 (7%) Frame = +1 Query: 106 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESY 252 + ++L+ ++ LK+K T G TL IQ+GV+N S VG+ A D ESY Sbjct: 404 MARHLSPRLYTKLKDKVTPNGYTLDMAIQTGVDNPGHPFISTVGLVAGDEESY 456 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 83.8 bits (198), Expect = 1e-16 Identities = 46/105 (43%), Positives = 63/105 (60%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 FAEL DP+IE H G+KKTDKH D G LDP ++V+S+RVR GRS+ G+ Sbjct: 2378 FAELLDPVIELRHGGYKKTDKHKTDLNPDNLKGGALDP--KYVLSSRVRTGRSIRGFCLP 2435 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 P + ++ + +E L+ L GE KG +Y L M+ E Q+QLI Sbjct: 2436 PHCSRAERRSVEKISVDALAKLDGEFKGKYYPLNKMTDEEQEQLI 2480 Score = 41.5 bits (93), Expect = 6e-04 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 4/53 (7%) Frame = +1 Query: 106 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESY 252 + K LT+E++ SL++K T G TL D IQ+GV+N VG A D ESY Sbjct: 2323 MAKVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDNPGHPFIMTVGCVAGDEESY 2375 >SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1115 Score = 81.4 bits (192), Expect = 6e-16 Identities = 42/105 (40%), Positives = 63/105 (60%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 FA++FDP+IE HNG+KKT KH + + +G D ++V+S RVR GRS+ G Sbjct: 425 FADMFDPVIEKRHNGYKKTAKHKT-DLNPSNLIGGDDLDEKYVLSCRVRTGRSIRGLCLP 483 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 P + ++ +E+E V+ L+ L G L G +Y L M++ Q QLI Sbjct: 484 PWCSRAERREVEKIVTSALAELDGPLAGKYYSLMTMTEAEQDQLI 528 Score = 80.6 bits (190), Expect = 1e-15 Identities = 43/105 (40%), Positives = 61/105 (58%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 FA++FDP+IE H+G++KTD H D +G D ++V+S RVR GRS+ G Sbjct: 56 FADMFDPVIEKRHDGYRKTDMHKTDLNPD-HLIGGDDLDEKYVLSCRVRTGRSIRGLGLP 114 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 P T ++ +E+E L SL GE KG +Y L+ M+ Q QLI Sbjct: 115 PHCTRAERREVEKVSVEALDSLDGEFKGKYYPLSNMTAAEQDQLI 159 Score = 74.9 bits (176), Expect = 5e-14 Identities = 43/105 (40%), Positives = 59/105 (56%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 FA L DP+IE HNG+ K KH D + +G D FV+S RVR GRS+ G Sbjct: 822 FAALLDPVIEARHNGYLKGAKHVTDLNPD-NLVGGDDLDANFVLSCRVRTGRSIRGLGLP 880 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 P T ++ +E+E L++L G LKG +Y L+ M+ Q+QLI Sbjct: 881 PHCTRAERREVEKITVDALATLDGPLKGKYYPLSKMTDAEQEQLI 925 Score = 41.1 bits (92), Expect = 8e-04 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 5/87 (5%) Frame = +1 Query: 7 SSARKAATMVDAATLEKLEAGFSKLQGSD-SKSLLKKYLTREVFDSLKNKKTSFGSTLLD 183 S AR+ A +A +K + ++ G + ++ + K+LTR+V++ L N KT G TL Sbjct: 734 SKAREEAIKKEAER-QKASSTLRRVPGPEQAQHYMAKFLTRDVYNKLCNLKTPSGFTLDG 792 Query: 184 CIQSGVEN----LDSGVGIYAPDAESY 252 IQ+GV+N VG A D E+Y Sbjct: 793 VIQTGVDNPGHPFIFTVGCVAGDEETY 819 Score = 34.3 bits (75), Expect = 0.089 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = +1 Query: 106 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESY 252 + K +T++V+ L N +T G TL IQ+GV+N VG A D ESY Sbjct: 1 MAKCMTKDVYQRLSNLRTPSGYTLDMAIQTGVDNPGHPFIMTVGCVAGDEESY 53 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +1 Query: 106 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESY 252 + K LT V++ L KT G TL IQ+GV+N VG A D ESY Sbjct: 370 MAKCLTPAVYNMLSVLKTPTGYTLDMAIQTGVDNPGHPFIMTVGCVAGDEESY 422 >SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 71.7 bits (168), Expect = 5e-13 Identities = 39/89 (43%), Positives = 51/89 (57%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFN 437 FA LFD +IEDYH+ +K D H D +LDP F+ STR+R GR+L+GY Sbjct: 237 FAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRNLKGYGLA 296 Query: 438 PCLTESQYKEMEDKVSGTLSSLRGELKGT 524 P LT+ + E+E K S T S +LK T Sbjct: 297 PSLTKKERVELEKKASFTAKS--SQLKTT 323 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +1 Query: 97 KSLLKKYLTREVFDSLKNKKTSFG 168 K LLKKYLT +VFD LK KKT G Sbjct: 174 KCLLKKYLTNQVFDQLKTKKTKRG 197 >SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 309 Score = 58.4 bits (135), Expect = 5e-09 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 1/106 (0%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFK-KTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPF 434 F + + P+I+ YH GF T KH + + D A ++STR+R R+L +P Sbjct: 14 FKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKIISTRIRVARNLSMFPL 73 Query: 435 NPCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 NP ++ E+ D ++ SL +L G Y T M+ E +Q+L+ Sbjct: 74 NPGGSKESRLEIIDLMAKVYDSLGDDLAGNLYRHTTMTDEERQKLV 119 >SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 383 Score = 58.4 bits (135), Expect = 5e-09 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 1/106 (0%) Frame = +3 Query: 258 FAELFDPIIEDYHNGFK-KTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPF 434 F + + P+I+ YH GF T KH + + D A ++STR+R R+L +P Sbjct: 106 FKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKIISTRIRVARNLSMFPL 165 Query: 435 NPCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 NP ++ E+ D ++ SL +L G Y T M+ E +Q+L+ Sbjct: 166 NPGGSKESRLEIIDLMAKVYDSLGDDLAGNLYRHTTMTDEERQKLV 211 >SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) Length = 490 Score = 41.5 bits (93), Expect = 6e-04 Identities = 27/78 (34%), Positives = 43/78 (55%) Frame = +3 Query: 345 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLRGELKGT 524 V G LD VVS RVR RSL+G+PF + ++ +E+++ V L SL+ E Sbjct: 279 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQALDSLK-EPDSE 334 Query: 525 FYHLTGMSKETQQQLIRR 578 +Y L +S +++ LI + Sbjct: 335 YYKLARISSKSRDTLITK 352 >SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) Length = 322 Score = 37.5 bits (83), Expect = 0.010 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = +3 Query: 345 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLRG 509 V G LD VVS RVR RSL+G+PF + ++ +E+++ V L SL+G Sbjct: 270 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQALDSLKG 321 >SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) Length = 132 Score = 35.5 bits (78), Expect = 0.038 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = +1 Query: 100 SLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENLD----SGVGIYAPDAESY 252 +++ ++LT E++ L ++KTS G TL IQ GV+N S GI A D ES+ Sbjct: 77 NIMARHLTPEMYVHLCDRKTSNGFTLDQAIQPGVDNPTHPNISPCGIVAGDEESF 131 >SB_21382| Best HMM Match : Ail_Lom (HMM E-Value=2.5) Length = 473 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = +3 Query: 393 TRVRCGRSLEGYPFNPCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQLI 572 T +CG G + L Y ++ D GT+ L KGT L K T ++L+ Sbjct: 32 TMRKCGTRFRGLCASVGLVSGDYAQVWDSFQGTMRELVTRFKGTMRELVTRFKGTMRELV 91 Query: 573 RR 578 R Sbjct: 92 TR 93 >SB_15059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = -3 Query: 514 SSPRRLDRVPETLSSISLYWDSVRQGLKGYPSSERPQRTRVETTNSPAGSRLPSVSTSP 338 S+P R+ + TLSSI + + KG P RPQ + + + AGS + +P Sbjct: 622 SAPPRVRHLDSTLSSIDNHVTRINSARKGRPL--RPQSSPAKVSFKKAGSEVEETPFNP 678 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 28.7 bits (61), Expect = 4.4 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +1 Query: 19 KAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSG 198 KAA + + L KL AG++ L D+ L + LT E LK K S + +Q Sbjct: 195 KAAVQLLKSVLPKLTAGYADLYHGDA---LVEVLTTEWHGDLKEKYPQDVSGIYQLVQGQ 251 Query: 199 VENLD 213 +E+ D Sbjct: 252 LESRD 256 >SB_871| Best HMM Match : 7tm_1 (HMM E-Value=0.0017) Length = 1675 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = -3 Query: 547 DMPVRW*NVPLSSPRRLDRVPETLSSISLYWDSVRQGLKGYPSSERPQRTRVETTNSPAG 368 D+P++ N P SP ++ + P S +++ +R YP+ RPQ + N G Sbjct: 1566 DIPLKSHNSP--SPAQVTQCPIFRPSHTIHHPPLRSRNVRYPAQVRPQYPLQASLNVKKG 1623 Query: 367 SRLP 356 +R+P Sbjct: 1624 ARVP 1627 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = +2 Query: 446 HRVPVQGDGGQGLRHPVQPSRRAQGHVLPSHRHVEG--DPAAAHSTTTSLFKEGDRFPA 616 H G QGL +P QP R A +PS G D A+ + + + D +PA Sbjct: 630 HDAVRSSSGPQGLVYPQQPIRTAAHQSMPSQNLPTGELDHASPPPAYSQVIQHRDMYPA 688 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 433 KGYPSSERPQRTRVETTNS-PAGSRLPSVSTSP 338 +G SSERP+R+R T + P S LP +++P Sbjct: 1178 RGSLSSERPERSRRRRTETEPRDSSLPCTASTP 1210 >SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) Length = 277 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = -1 Query: 150 VLQAVEYFPGKVLLQQRLRVGSLELAETSLQFLEGCGVDH 31 + +AV P +V+L R+++GS +LA+ L+ L+G G++H Sbjct: 204 ITRAVIDGPLRVVL--RVQIGSCDLADEHLRKLDGGGLEH 241 >SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) Length = 362 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 224 PTPESKFSTPDWMQSRRVDPNEVFLFFRLSNTS 126 P P+ KFS P + SR +D E L F L+ S Sbjct: 5 PKPKEKFSEPVIIASRNLDSVEARLAFNLTTVS 37 >SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) Length = 353 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 61 EAGFSKLQGSDSKSL-LKKYLTREVFDSLKNKKTSFGSTLLDCI 189 + G+ +G SK+L L+K V D LK +FG L +C+ Sbjct: 30 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 73 >SB_38230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 493 CPAFEASSRARSTISQACRRRPSSSSFDDHFLVQ 594 C F+ SSR+ +T + A R P++S DH Q Sbjct: 69 CVLFKTSSRSDATRTHATARFPNTSGKSDHTTTQ 102 >SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) Length = 809 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 185 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 72 Q R D N V++ +R L F DL+ PWS+L Sbjct: 65 QDRAADKNHVYISYR-DCKKLDEEAFPEDLDEAPWSVL 101 >SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) Length = 398 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 61 EAGFSKLQGSDSKSL-LKKYLTREVFDSLKNKKTSFGSTLLDCI 189 + G+ +G SK+L L+K V D LK +FG L +C+ Sbjct: 75 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 118 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 420 EGYPFNPCLTESQYKEMEDKVSGTLSSLRGELKGTFYHLTGMSKETQQQL 569 +GY ES+ EME + + + GE++ Y+ +SK+ +Q L Sbjct: 818 KGYQDQIRSLESRNNEMEQEYGDKMLEMEGEIEDLGYNFDQLSKKLRQDL 867 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.129 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,661,950 Number of Sequences: 59808 Number of extensions: 402711 Number of successful extensions: 1637 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1626 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -