BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0509 (406 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 5.3 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 7.0 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 7.0 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.0 bits (42), Expect = 5.3 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = -1 Query: 289 RKQSQQQSVH*CSEN----VQARDGTCIXCGLSLR 197 R + Q S C E VQ R+G+ I C +S R Sbjct: 345 RARGNQPSTSECGEFRSVVVQKRNGSMIECNISPR 379 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 7.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 232 LWLERSPNINEPT 270 LWL SPN ++ T Sbjct: 660 LWLNHSPNYDQVT 672 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 7.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 401 ISPRRYXPRW*GWTRR 354 + R Y PR+ WT R Sbjct: 468 LQDREYCPRYIKWTNR 483 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,294 Number of Sequences: 438 Number of extensions: 2245 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10132494 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -