BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0500 (385 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC014532-1|AAH14532.1| 337|Homo sapiens decapping enzyme, scave... 46 4e-05 AY077684-1|AAL77216.1| 337|Homo sapiens heat shock-like protein... 46 4e-05 AY040771-1|AAK91765.1| 337|Homo sapiens histidine triad protein... 46 4e-05 AK223089-1|BAD96809.1| 337|Homo sapiens mRNA decapping enzyme v... 46 4e-05 AF532613-1|AAM90310.1| 337|Homo sapiens scavenger mRNA decappin... 46 4e-05 >BC014532-1|AAH14532.1| 337|Homo sapiens decapping enzyme, scavenger protein. Length = 337 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 260 QLXTFFENXIYGNFXCFPXSTINGVKTTIIYPAXXKHIAKF 382 +L F N IY + FP +N VKTT++YPA KH+ K+ Sbjct: 103 ELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKY 143 >AY077684-1|AAL77216.1| 337|Homo sapiens heat shock-like protein 1 protein. Length = 337 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 260 QLXTFFENXIYGNFXCFPXSTINGVKTTIIYPAXXKHIAKF 382 +L F N IY + FP +N VKTT++YPA KH+ K+ Sbjct: 103 ELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKY 143 >AY040771-1|AAK91765.1| 337|Homo sapiens histidine triad protein member 5 protein. Length = 337 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 260 QLXTFFENXIYGNFXCFPXSTINGVKTTIIYPAXXKHIAKF 382 +L F N IY + FP +N VKTT++YPA KH+ K+ Sbjct: 103 ELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKY 143 >AK223089-1|BAD96809.1| 337|Homo sapiens mRNA decapping enzyme variant protein. Length = 337 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 260 QLXTFFENXIYGNFXCFPXSTINGVKTTIIYPAXXKHIAKF 382 +L F N IY + FP +N VKTT++YPA KH+ K+ Sbjct: 103 ELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKY 143 >AF532613-1|AAM90310.1| 337|Homo sapiens scavenger mRNA decapping enzyme protein. Length = 337 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 260 QLXTFFENXIYGNFXCFPXSTINGVKTTIIYPAXXKHIAKF 382 +L F N IY + FP +N VKTT++YPA KH+ K+ Sbjct: 103 ELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKY 143 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,280,315 Number of Sequences: 237096 Number of extensions: 554528 Number of successful extensions: 692 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 692 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2583773550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -