BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0500 (385 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001389-1|AAN71144.1| 374|Drosophila melanogaster GH04919p pro... 49 2e-06 AE014297-342|AAF51960.1| 374|Drosophila melanogaster CG2091-PA ... 49 2e-06 >BT001389-1|AAN71144.1| 374|Drosophila melanogaster GH04919p protein. Length = 374 Score = 49.2 bits (112), Expect = 2e-06 Identities = 23/53 (43%), Positives = 30/53 (56%) Frame = +2 Query: 227 PKXRGLFLQKTQLXTFFENXIYGNFXCFPXSTINGVKTTIIYPAXXKHIAKFS 385 PK F ++ T F N IYG+F P + VK+T+IYPA KHI K+S Sbjct: 72 PKKPSYFTADLKVDTEFINNIYGSFQVVPTQDLCSVKSTVIYPATEKHIEKYS 124 Score = 34.7 bits (76), Expect = 0.042 Identities = 16/45 (35%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +3 Query: 102 FVLEKILNNNTNRXTACVVGKFKDK-SGVALILFEKNAFKXNXLS 233 F L++IL NN+ R + ++G F D + A+++FEKNA++ + ++ Sbjct: 20 FQLKRILTNNSVRKSISLLGTFPDLGTDDAIVVFEKNAYRESDVA 64 >AE014297-342|AAF51960.1| 374|Drosophila melanogaster CG2091-PA protein. Length = 374 Score = 49.2 bits (112), Expect = 2e-06 Identities = 23/53 (43%), Positives = 30/53 (56%) Frame = +2 Query: 227 PKXRGLFLQKTQLXTFFENXIYGNFXCFPXSTINGVKTTIIYPAXXKHIAKFS 385 PK F ++ T F N IYG+F P + VK+T+IYPA KHI K+S Sbjct: 72 PKKPSYFTADLKVDTEFINNIYGSFQVVPTQDLCSVKSTVIYPATEKHIEKYS 124 Score = 34.7 bits (76), Expect = 0.042 Identities = 16/45 (35%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +3 Query: 102 FVLEKILNNNTNRXTACVVGKFKDK-SGVALILFEKNAFKXNXLS 233 F L++IL NN+ R + ++G F D + A+++FEKNA++ + ++ Sbjct: 20 FQLKRILTNNSVRKSISLLGTFPDLGTDDAIVVFEKNAYRESDVA 64 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,959,578 Number of Sequences: 53049 Number of extensions: 169916 Number of successful extensions: 287 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1045179750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -